eF-site ID 2vrf-A PDB Code 2vrf Chain A click to enlarge Title CRYSTAL STRUCTURE OF THE HUMAN BETA-2-SYNTROPHIN PDZ DOMAIN Classification PROTEIN BINDING Compound BETA-2-SYNTROPHIN Source Homo sapiens (Human) (SNTB2_HUMAN) Sequence A:  SMPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGL AADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKE VLLEVKFIREVNTVV Description Functional site 1) chain A residue 153 type sequence Q description BINDING SITE FOR RESIDUE EDO A 1205 source : AC2 2) chain A residue 154 type sequence S description BINDING SITE FOR RESIDUE EDO A 1205 source : AC2 3) chain A residue 115 type sequence R description BINDING SITE FOR RESIDUE EDO A 1206 source : AC3 4) chain A residue 165 type sequence S description BINDING SITE FOR RESIDUE EDO A 1206 source : AC3 5) chain A residue 167 type sequence N description BINDING SITE FOR RESIDUE EDO A 1206 source : AC3 6) chain A residue 168 type sequence G description BINDING SITE FOR RESIDUE EDO A 1206 source : AC3 7) chain A residue 191 type sequence L description BINDING SITE FOR RESIDUE EDO A 1206 source : AC3 8) chain A residue 193 type sequence E description BINDING SITE FOR RESIDUE EDO A 1206 source : AC3 9) chain A residue 129 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links