eF-site ID 2vp5-AB PDB Code 2vp5 Chain A, B click to enlarge Title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase Classification TRANSFERASE Compound DEOXYNUCLEOSIDE KINASE Source null (DNK_DROME) Sequence A:  TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKW RNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTN KKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYK FIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPL KYLQELHELHEDWLIHQRRPQSCKVLVLDAD B:  TQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKW RNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTN KKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYK FIEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPL KYLQELHELHEDWLIHCKVLVLDAD Description Functional site 1) chain A residue 30 type sequence G description BINDING SITE FOR RESIDUE SO4 A1209 source : AC1 2) chain A residue 31 type sequence S description BINDING SITE FOR RESIDUE SO4 A1209 source : AC1 3) chain A residue 32 type sequence G description BINDING SITE FOR RESIDUE SO4 A1209 source : AC1 4) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 A1209 source : AC1 5) chain A residue 34 type sequence T description BINDING SITE FOR RESIDUE SO4 A1209 source : AC1 6) chain A residue 167 type sequence R description BINDING SITE FOR RESIDUE SO4 A1209 source : AC1 7) chain B residue 28 type sequence N description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 8) chain B residue 30 type sequence G description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 9) chain B residue 31 type sequence S description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 10) chain B residue 32 type sequence G description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 11) chain B residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 12) chain B residue 34 type sequence T description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 13) chain B residue 167 type sequence R description BINDING SITE FOR RESIDUE SO4 B1209 source : AC2 14) chain A residue 29 type sequence I description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 15) chain A residue 52 type sequence E description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 16) chain A residue 57 type sequence W description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 17) chain A residue 66 type sequence L description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 18) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 19) chain A residue 70 type sequence Y description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 20) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 21) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 22) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 23) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 24) chain A residue 110 type sequence A description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 25) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 26) chain A residue 172 type sequence E description BINDING SITE FOR RESIDUE DCZ A1210 source : AC3 27) chain B residue 29 type sequence I description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 28) chain B residue 52 type sequence E description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 29) chain B residue 57 type sequence W description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 30) chain B residue 66 type sequence L description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 31) chain B residue 69 type sequence M description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 32) chain B residue 70 type sequence Y description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 33) chain B residue 80 type sequence F description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 34) chain B residue 81 type sequence Q description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 35) chain B residue 84 type sequence V description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 36) chain B residue 105 type sequence R description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 37) chain B residue 110 type sequence A description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 38) chain B residue 114 type sequence F description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 39) chain B residue 169 type sequence R description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 40) chain B residue 172 type sequence E description BINDING SITE FOR RESIDUE DCZ B1210 source : AC4 41) chain A residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 42) chain B residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 43) chain A residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 44) chain B residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 46) chain A residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 47) chain A residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 48) chain A residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 49) chain A residue 172 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 50) chain B residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 51) chain B residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 52) chain B residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 53) chain B residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 54) chain B residue 172 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links