eF-site ID 2vp0-AB PDB Code 2vp0 Chain A, B click to enlarge Title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase Classification TRANSFERASE Compound DEOXYNUCLEOSIDE KINASE Source Drosophila melanogaster (Fruit fly) (DNK_DROME) Sequence A:  TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLT EPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQS HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT LEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSE ESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD B:  TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLT EPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQS HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT LEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRARSE ESCVPLKYLQELHELHEDWLIHQRRPQSCKVLVLDAD Description Functional site 1) chain A residue 34 type sequence T description BINDING SITE FOR RESIDUE MG A1209 source : AC1 2) chain A residue 52 type sequence E description BINDING SITE FOR RESIDUE MG A1209 source : AC1 3) chain A residue 104 type sequence E description BINDING SITE FOR RESIDUE MG A1209 source : AC1 4) chain B residue 34 type sequence T description BINDING SITE FOR RESIDUE MG B1209 source : AC2 5) chain B residue 52 type sequence E description BINDING SITE FOR RESIDUE MG B1209 source : AC2 6) chain B residue 104 type sequence E description BINDING SITE FOR RESIDUE MG B1209 source : AC2 7) chain A residue 29 type sequence I description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 8) chain A residue 30 type sequence G description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 9) chain A residue 31 type sequence S description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 10) chain A residue 32 type sequence G description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 11) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 12) chain A residue 34 type sequence T description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 13) chain A residue 52 type sequence E description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 14) chain A residue 54 type sequence V description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 15) chain A residue 57 type sequence W description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 16) chain A residue 66 type sequence L description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 17) chain A residue 69 type sequence M description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 18) chain A residue 70 type sequence Y description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 19) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 20) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 21) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 22) chain A residue 104 type sequence E description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 23) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 24) chain A residue 110 type sequence A description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 25) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 26) chain A residue 167 type sequence R description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 27) chain A residue 169 type sequence R description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 28) chain A residue 172 type sequence E description BINDING SITE FOR RESIDUE TTP A1210 source : AC3 29) chain B residue 29 type sequence I description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 30) chain B residue 30 type sequence G description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 31) chain B residue 31 type sequence S description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 32) chain B residue 32 type sequence G description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 33) chain B residue 33 type sequence K description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 34) chain B residue 34 type sequence T description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 35) chain B residue 52 type sequence E description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 36) chain B residue 57 type sequence W description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 37) chain B residue 66 type sequence L description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 38) chain B residue 69 type sequence M description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 39) chain B residue 70 type sequence Y description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 40) chain B residue 80 type sequence F description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 41) chain B residue 81 type sequence Q description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 42) chain B residue 104 type sequence E description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 43) chain B residue 105 type sequence R description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 44) chain B residue 110 type sequence A description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 45) chain B residue 114 type sequence F description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 46) chain B residue 167 type sequence R description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 47) chain B residue 169 type sequence R description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 48) chain B residue 172 type sequence E description BINDING SITE FOR RESIDUE TTP B1210 source : AC4 49) chain A residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 50) chain B residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 51) chain A residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 52) chain B residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 54) chain B residue 172 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 55) chain A residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 56) chain A residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 57) chain A residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 58) chain A residue 172 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 59) chain B residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 60) chain B residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 61) chain B residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 62) chain B residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links