eF-site ID 2voh-A PDB Code 2voh Chain A click to enlarge Title Structure of mouse A1 bound to the Bak BH3-domain Classification APOPTOSIS Compound BCL-2-RELATED PROTEIN A1 Source Mus musculus (Mouse) (BAK_MOUSE) Sequence A:  GPLGSMAESELMHIHSLAEHYLQYVLQVPAFESAPSQACR VLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVM EKEFEDGIINWGRIVTIFAFGGVLLKKLKQEQIALDVSAY KQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEP Description Functional site 1) chain A residue 42 type sequence F description BINDING SITE FOR RESIDUE SO4 B1088 source : AC1 2) chain A residue 46 type sequence K description BINDING SITE FOR RESIDUE SO4 B1088 source : AC1 3) chain A residue 77 type sequence K description BINDING SITE FOR RESIDUE SO4 B1088 source : AC1 4) chain A residue 5 type sequence E description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 5) chain A residue 8 type sequence H description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 6) chain A residue 138 type sequence G description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 7) chain A residue 139 type sequence G description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 8) chain A residue 140 type sequence W description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 9) chain A residue 141 type sequence E description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 10) chain A residue 142 type sequence D description BINDING SITE FOR RESIDUE CIT A1151 source : AC2 11) chain A residue 78-97 type prosite sequence EFEDGIINWGRIVTIFAFGG description BH1 Apoptosis regulator, Bcl-2 family BH1 motif signature. EFeDGiiNWGRIVTIFaFGG source prosite : PS01080 12) chain A residue 133-144 type prosite sequence WIRQNGGWEDGF description BH2 Apoptosis regulator, Bcl-2 family BH2 motif signature. WIrqnGGWEdGF source prosite : PS01258

Display surface Download Links