eF-site ID 2vnf-C PDB Code 2vnf Chain C click to enlarge Title MOLECULAR BASIS OF HISTONE H3K4ME3 RECOGNITION BY ING4 Classification CELL CYCLE Compound INHIBITOR OF GROWTH PROTEIN 4 Source null (Q5TEC6_HUMAN) Sequence C:  VDPNEPTYCLCHQVSYGEMIGCDNPDCSIEWFHFACVGLT TKPRGKWFCPRCSQ Description Functional site 1) chain C residue 202 type sequence H description BINDING SITE FOR RESIDUE DTU C 1246 source : AC3 2) chain C residue 214 type sequence N description BINDING SITE FOR RESIDUE DTU C 1246 source : AC3 3) chain C residue 244 type sequence Q description BINDING SITE FOR RESIDUE DTU C 1246 source : AC3 4) chain C residue 199 type sequence C description BINDING SITE FOR RESIDUE ZN C 1247 source : AC5 5) chain C residue 201 type sequence C description BINDING SITE FOR RESIDUE ZN C 1247 source : AC5 6) chain C residue 223 type sequence H description BINDING SITE FOR RESIDUE ZN C 1247 source : AC5 7) chain C residue 226 type sequence C description BINDING SITE FOR RESIDUE ZN C 1247 source : AC5 8) chain C residue 212 type sequence C description BINDING SITE FOR RESIDUE ZN C 1248 source : AC6 9) chain C residue 217 type sequence C description BINDING SITE FOR RESIDUE ZN C 1248 source : AC6 10) chain C residue 239 type sequence C description BINDING SITE FOR RESIDUE ZN C 1248 source : AC6 11) chain C residue 242 type sequence C description BINDING SITE FOR RESIDUE ZN C 1248 source : AC6 12) chain C residue 201 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 13) chain C residue 212 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 14) chain C residue 217 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 15) chain C residue 223 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 16) chain C residue 226 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 17) chain C residue 239 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 18) chain C residue 242 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 19) chain C residue 199 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 20) chain C residue 198 type MOD_RES sequence Y description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 21) chain C residue 209 type MOD_RES sequence M description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 22) chain C residue 213 type MOD_RES sequence D description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 23) chain C residue 221 type MOD_RES sequence W description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links