eF-site ID 2vel-AB PDB Code 2vel Chain A, B click to enlarge Title Structure-based enzyme engineering efforts with an inactive monomeric TIM variant: the importance of a single point mutation for generating an active site with suitable binding properties Classification ISOMERASE Compound GLYCOSOMAL TRIOSEPHOSPHATE ISOMERASE Source (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVA STFVHLAMTKERLSHPKFVIAAQNAGNADALASLKDFGVN WIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPV WAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRIL YGGSVNGKNARTLYQQRDVNGFLAGLKPEFVDIIKATQ B:  SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVA STFVHLAMTKERLSHPKFVIAAQNAGNADALASLKDFGVN WIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPV WAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRIL YGGSVNGKNARTLYQQRDVNGFLAGLKPEFVDIIKATQ Description Functional site 1) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE CL A1251 source : AC1 2) chain A residue 35 type sequence H description BINDING SITE FOR RESIDUE CL A1251 source : AC1 3) chain A residue 98 type sequence R description BINDING SITE FOR RESIDUE CL B1251 source : AC2 4) chain A residue 102 type sequence Y description BINDING SITE FOR RESIDUE CL B1251 source : AC2 5) chain B residue 98 type sequence R description BINDING SITE FOR RESIDUE CL B1251 source : AC2 6) chain B residue 102 type sequence Y description BINDING SITE FOR RESIDUE CL B1251 source : AC2 7) chain B residue 11 type sequence N description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 8) chain B residue 13 type sequence K description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 9) chain B residue 95 type sequence H description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 10) chain B residue 167 type sequence E description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 11) chain B residue 171 type sequence A description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 12) chain B residue 172 type sequence I description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 13) chain B residue 173 type sequence G description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 14) chain B residue 213 type sequence S description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 15) chain B residue 232 type sequence L description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 16) chain B residue 233 type sequence A description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 17) chain B residue 234 type sequence G description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 18) chain B residue 239 type sequence K description BINDING SITE FOR RESIDUE PGA B1252 source : AC3 19) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 20) chain A residue 13 type sequence K description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 21) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 22) chain A residue 167 type sequence E description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 23) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 24) chain A residue 172 type sequence I description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 25) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 26) chain A residue 212 type sequence G description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 27) chain A residue 213 type sequence S description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 28) chain A residue 234 type sequence G description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 29) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 30) chain B residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 31) chain A residue 103 type ACT_SITE sequence G description Electrophile source Swiss-Prot : SWS_FT_FI1 32) chain B residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 33) chain A residue 175 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI2 34) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 35) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 36) chain B residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 37) chain B residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links