eF-site ID 2vel-A PDB Code 2vel Chain A click to enlarge Title Structure-based enzyme engineering efforts with an inactive monomeric TIM variant: the importance of a single point mutation for generating an active site with suitable binding properties Classification ISOMERASE Compound GLYCOSOMAL TRIOSEPHOSPHATE ISOMERASE Source (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVA STFVHLAMTKERLSHPKFVIAAQNAGNADALASLKDFGVN WIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPV WAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRIL YGGSVNGKNARTLYQQRDVNGFLAGLKPEFVDIIKATQ Description Functional site 1) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE CL A1251 source : AC1 2) chain A residue 35 type sequence H description BINDING SITE FOR RESIDUE CL A1251 source : AC1 3) chain A residue 98 type sequence R description BINDING SITE FOR RESIDUE CL B1251 source : AC2 4) chain A residue 102 type sequence Y description BINDING SITE FOR RESIDUE CL B1251 source : AC2 5) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 6) chain A residue 13 type sequence K description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 7) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 8) chain A residue 167 type sequence E description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 9) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 10) chain A residue 172 type sequence I description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 11) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 12) chain A residue 212 type sequence G description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 13) chain A residue 213 type sequence S description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 14) chain A residue 234 type sequence G description BINDING SITE FOR RESIDUE PGA A1252 source : AC4 15) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 16) chain A residue 103 type ACT_SITE sequence G description Electrophile source Swiss-Prot : SWS_FT_FI1 17) chain A residue 175 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI2 18) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 19) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links