eF-site ID 2vei-A PDB Code 2vei Chain A click to enlarge Title Structure-based enzyme engineering efforts with an inactive monomeric TIM variant: the importance of a single point mutation for generating an active site with suitable binding properties Classification ISOMERASE Compound GLYCOSOMAL TRIOSEPHOSPHATE ISOMERASE Source Trypanosoma brucei brucei (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVA STFVHLAMTKERLSHPKFVIAAQNAGNADALASLKDFGVN WIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPV WAIGTGKVATPQQAQEAHALIRSWVSSKIGADVAGELRIL YGGSVNGKNARTLYQQRDVNGFLVGLKPEFVDIIKATQ Description Functional site 1) chain A residue 15 type sequence S description BINDING SITE FOR RESIDUE SO4 A1251 source : AC1 2) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE SO4 A1251 source : AC1 3) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE SO4 A1252 source : AC3 4) chain A residue 17 type sequence S description BINDING SITE FOR RESIDUE SO4 A1252 source : AC3 5) chain A residue 134 type sequence R description BINDING SITE FOR RESIDUE SO4 A1253 source : AC4 6) chain A residue 182 type sequence Q description BINDING SITE FOR RESIDUE SO4 A1253 source : AC4 7) chain A residue 155 type sequence K description BINDING SITE FOR RESIDUE SO4 A1254 source : BC4 8) chain A residue 156 type sequence K description BINDING SITE FOR RESIDUE SO4 A1254 source : BC4 9) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE SO4 A1255 source : BC7 10) chain A residue 59 type sequence K description BINDING SITE FOR RESIDUE SO4 A1255 source : BC7 11) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 12) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 13) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3 14) chain A residue 103 type ACT_SITE sequence G description Electrophile source Swiss-Prot : SWS_FT_FI1 15) chain A residue 175 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI2

Display surface Download Links