eF-site ID 2vdp-A PDB Code 2vdp Chain A click to enlarge Title Integrin AlphaIIbBeta3 Headpiece Bound to Fibrinogen Gamma chain peptide,LGGAKQAGDV Classification CELL ADHESION/IMMUNE SYSTEM Compound INTEGRIN ALPHA-IIB Source ORGANISM_COMMON: MOUSE; ORGANISM_SCIENTIFIC: MUS MUSCULUS; Sequence A:  LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAP RTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVG SQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTE EAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDF SWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPV ADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVA VGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRL RGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADR KLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAI APLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLR SRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAY GANQVAVYRAQP Description (1)  INTEGRIN ALPHA-IIB, INTEGRIN BETA-3, FIBRINOGEN, MONOCLONAL ANTIBODY 10E5 HEAVY CHAIN, MONOCLONAL ANTIBODY 10E5 LIGHT CHAIN Functional site 1) chain A residue 247 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 2) chain A residue 250 type CROSSLNK sequence T description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 3) chain A residue 252 type CROSSLNK sequence E description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 4) chain A residue 297 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 5) chain A residue 299 type CROSSLNK sequence N description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 6) chain A residue 301 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 7) chain A residue 434 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 8) chain A residue 303 type CROSSLNK sequence R description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 9) chain A residue 305 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 10) chain A residue 365 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 11) chain A residue 367 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 12) chain A residue 369 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 13) chain A residue 371 type CROSSLNK sequence Y description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 14) chain A residue 373 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 15) chain A residue 426 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 16) chain A residue 428 type CROSSLNK sequence D description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 17) chain A residue 430 type CROSSLNK sequence N description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1 18) chain A residue 432 type CROSSLNK sequence Y description Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-424) source Swiss-Prot : SWS_FT_FI1

Display surface Download Links