eF-site ID 2v89-B PDB Code 2v89 Chain B click to enlarge Title Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution Classification PROTEIN BINDING Compound VDJ RECOMBINATION-ACTIVATING PROTEIN 2 Source (Q5TEC6_HUMAN) Sequence B:  GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHW VHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA Description Functional site 1) chain B residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 2) chain B residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 3) chain B residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 4) chain B residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 5) chain B residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 6) chain B residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 7) chain B residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 8) chain B residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 9) chain B residue 423 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 10) chain B residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 11) chain B residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 12) chain B residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 13) chain B residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 14) chain B residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 15) chain B residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 16) chain B residue 419 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links