eF-site ID 2v89-ABDE PDB Code 2v89 Chain A, B, D, E click to enlarge Title Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution Classification PROTEIN BINDING Compound VDJ RECOMBINATION-ACTIVATING PROTEIN 2 Source (Q5TEC6_HUMAN) Sequence A:  SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHG DGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA B:  GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHW VHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA D:  ARTXQTAAKA E:  ARTXQTAAKA Description Functional site 1) chain A residue 1419 type sequence C description BINDING SITE FOR RESIDUE ZN A 2488 source : AC1 2) chain A residue 1423 type sequence C description BINDING SITE FOR RESIDUE ZN A 2488 source : AC1 3) chain A residue 1455 type sequence H description BINDING SITE FOR RESIDUE ZN A 2488 source : AC1 4) chain A residue 1458 type sequence C description BINDING SITE FOR RESIDUE ZN A 2488 source : AC1 5) chain A residue 1446 type sequence C description BINDING SITE FOR RESIDUE ZN A 2489 source : AC2 6) chain A residue 1452 type sequence H description BINDING SITE FOR RESIDUE ZN A 2489 source : AC2 7) chain A residue 1478 type sequence C description BINDING SITE FOR RESIDUE ZN A 2489 source : AC2 8) chain A residue 1481 type sequence H description BINDING SITE FOR RESIDUE ZN A 2489 source : AC2 9) chain B residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 10) chain B residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 11) chain B residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 12) chain B residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 13) chain B residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 14) chain B residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 15) chain B residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 16) chain B residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 17) chain D residue 3010 type MOD_RES sequence A description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16457588 source Swiss-Prot : SWS_FT_FI8 18) chain E residue 2010 type MOD_RES sequence A description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:12560483, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16457588 source Swiss-Prot : SWS_FT_FI8 19) chain D residue 3004 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 20) chain E residue 2004 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 21) chain D residue 3005 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 22) chain E residue 2005 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 23) chain D residue 3006 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 24) chain E residue 2006 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 25) chain D residue 3008 type MOD_RES sequence A description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433 source Swiss-Prot : SWS_FT_FI6 26) chain E residue 2008 type MOD_RES sequence A description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433 source Swiss-Prot : SWS_FT_FI6 27) chain D residue 3009 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 28) chain E residue 2009 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 29) chain D residue 3002 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 30) chain E residue 2002 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 31) chain D residue 3003 type MOD_RES sequence T description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 32) chain B residue 423 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 33) chain B residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 34) chain B residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 35) chain B residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 36) chain B residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 37) chain B residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 38) chain B residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 39) chain E residue 2003 type MOD_RES sequence T description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 40) chain A residue 1446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 1452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 1455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 1458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 1478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 1481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 46) chain B residue 419 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links