eF-site ID 2v87-ABDE PDB Code 2v87 Chain A, B, D, E click to enlarge Title Crystal structure of RAG2-PHD finger in complex with H3R2me2sK4me3 peptide Classification PROTEIN BINDING Compound VDJ RECOMBINATION-ACTIVATING PROTEIN 2 Source (H32_MOUSE) Sequence A:  SPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHG DGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA B:  GSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSH GDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA D:  AXTXQTARKS E:  AXTXQTARKSTGG Description Functional site 1) chain A residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC1 2) chain A residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC1 3) chain A residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN A 1487 source : AC1 4) chain A residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC1 5) chain A residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN A 1488 source : AC2 6) chain A residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN A 1488 source : AC2 7) chain A residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN A 1488 source : AC2 8) chain A residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN A 1488 source : AC2 9) chain B residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 10) chain B residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 11) chain B residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 12) chain B residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 13) chain B residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 14) chain B residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 15) chain B residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 16) chain B residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 17) chain D residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 18) chain E residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 19) chain D residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI5 20) chain E residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI5 21) chain D residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000269|PubMed:15485929 source Swiss-Prot : SWS_FT_FI6 22) chain E residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000269|PubMed:15485929 source Swiss-Prot : SWS_FT_FI6 23) chain D residue 9 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:13678296, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 24) chain E residue 9 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:13678296, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 25) chain D residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:15735677, ECO:0000269|PubMed:15870105 source Swiss-Prot : SWS_FT_FI8 26) chain E residue 10 type MOD_RES sequence S description Phosphoserine; alternate; by AURKB, AURKC, RPS6KA3, RPS6KA4 and RPS6KA5 => ECO:0000269|PubMed:10464286, ECO:0000269|PubMed:11856369, ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:15735677, ECO:0000269|PubMed:15870105 source Swiss-Prot : SWS_FT_FI8 27) chain E residue 11 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000250|UniProtKB:P68431 source Swiss-Prot : SWS_FT_FI9 28) chain D residue 2 type MOD_RES sequence X description Citrulline; alternate => ECO:0000269|PubMed:15339660 source Swiss-Prot : SWS_FT_FI1 29) chain E residue 2 type MOD_RES sequence X description Citrulline; alternate => ECO:0000269|PubMed:15339660 source Swiss-Prot : SWS_FT_FI1 30) chain D residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 31) chain E residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 36) chain B residue 423 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 37) chain B residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 38) chain B residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 39) chain B residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 40) chain B residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 41) chain B residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 42) chain B residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 43) chain B residue 419 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610 source Swiss-Prot : SWS_FT_FI2 46) chain D residue 4 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 47) chain E residue 4 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links