eF-site ID 2v83-C PDB Code 2v83 Chain C click to enlarge Title Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide Classification PROTEIN BINDING Compound VDJ RECOMBINATION-ACTIVATING PROTEIN 2 Source (Q5TEC6_HUMAN) Sequence C:  GSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSH GDGHWVHAQCMDLEERTLIHLSNKYYCNEHVQ Description Functional site 1) chain C residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 2) chain C residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 3) chain C residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 4) chain C residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 5) chain C residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 6) chain C residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 7) chain C residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 8) chain C residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 9) chain C residue 419 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 10) chain C residue 423 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 11) chain C residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 12) chain C residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 13) chain C residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 14) chain C residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 15) chain C residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2 16) chain C residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN and VRK1 => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:31527692 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links