eF-site ID 2v83-ABCDE PDB Code 2v83 Chain A, B, C, D, E click to enlarge Title Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide Classification PROTEIN BINDING Compound VDJ RECOMBINATION-ACTIVATING PROTEIN 2 Source (Q5TEC6_HUMAN) Sequence A:  GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHW VHAQCMDLEERTLIHLSEGSNKYYCNEHVQIA B:  GSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSH GDGHWVHAQCMDLEERTLIHLSEGSNKYYCNEHVQIARA C:  GSPEFGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSH GDGHWVHAQCMDLEERTLIHLSNKYYCNEHVQ D:  ARTXQTARK E:  ARTXQTARK Description (1)  VDJ RECOMBINATION-ACTIVATING PROTEIN 2, HISTONE H3 Functional site 1) chain A residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 2) chain A residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 3) chain A residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 4) chain A residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 5) chain A residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 6) chain A residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 7) chain A residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 8) chain A residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 9) chain B residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 10) chain B residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 11) chain B residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 12) chain B residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN B 1488 source : AC3 13) chain B residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 14) chain B residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 15) chain B residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 16) chain B residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN B 1489 source : AC4 17) chain C residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 18) chain C residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 19) chain C residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 20) chain C residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN C 1484 source : AC5 21) chain C residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 22) chain C residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 23) chain C residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 24) chain C residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN C 1485 source : AC6 25) chain D residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 26) chain B residue 423 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 27) chain B residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 28) chain B residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 29) chain B residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 30) chain B residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 31) chain B residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 32) chain B residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 33) chain C residue 419 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 34) chain C residue 423 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 35) chain C residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 36) chain E residue 3 type MOD_RES sequence T description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 37) chain C residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 38) chain C residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 39) chain C residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 40) chain C residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 41) chain C residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 47) chain A residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 48) chain B residue 419 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 49) chain D residue 9 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 50) chain E residue 9 type MOD_RES sequence K description N6-methyllysine; alternate => ECO:0000269|PubMed:11242053, ECO:0000269|PubMed:16185088, ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI7 51) chain D residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 52) chain E residue 5 type MOD_RES sequence Q description 5-glutamyl serotonin; alternate => ECO:0000269|PubMed:30867594 source Swiss-Prot : SWS_FT_FI4 53) chain D residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 54) chain E residue 6 type MOD_RES sequence T description Phosphothreonine; by PKC => ECO:0000269|PubMed:20228790 source Swiss-Prot : SWS_FT_FI5 55) chain D residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433 source Swiss-Prot : SWS_FT_FI6 56) chain E residue 8 type MOD_RES sequence R description Symmetric dimethylarginine; by PRMT5; alternate => ECO:0000250|UniProtKB:P68433 source Swiss-Prot : SWS_FT_FI6 57) chain D residue 2 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 58) chain E residue 2 type MOD_RES sequence R description Citrulline; alternate => ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 59) chain D residue 4 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3 60) chain E residue 4 type MOD_RES sequence X description N6-methyllysine; alternate => ECO:0000269|PubMed:16267050, ECO:0000269|PubMed:16457588, ECO:0000269|PubMed:17194708 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links