eF-site ID 2v83-A PDB Code 2v83 Chain A click to enlarge Title Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide Classification PROTEIN BINDING Compound VDJ RECOMBINATION-ACTIVATING PROTEIN 2 Source (Q5TEC6_HUMAN) Sequence A:  GYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHW VHAQCMDLEERTLIHLSEGSNKYYCNEHVQIA Description (1)  VDJ RECOMBINATION-ACTIVATING PROTEIN 2, HISTONE H3 Functional site 1) chain A residue 419 type sequence C description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 2) chain A residue 423 type sequence C description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 3) chain A residue 455 type sequence H description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 4) chain A residue 458 type sequence C description BINDING SITE FOR RESIDUE ZN A 1486 source : AC1 5) chain A residue 446 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 6) chain A residue 452 type sequence H description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 7) chain A residue 478 type sequence C description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 8) chain A residue 481 type sequence H description BINDING SITE FOR RESIDUE ZN A 1487 source : AC2 9) chain A residue 446 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 452 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 455 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 458 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 478 type MOD_RES sequence C description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 481 type MOD_RES sequence H description Phosphothreonine; by HASPIN => ECO:0000269|PubMed:15681610, ECO:0000269|PubMed:16185088 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links