eF-site ID 2v2h-A PDB Code 2v2h Chain A click to enlarge Title The A178L mutation in the C-terminal hinge of the flexible loop-6 of triosephosphate isomerase (TIM) induces a more closed conformation of this hinge region in dimeric and monomeric TIM Classification ISOMERASE Compound TRIOSEPHOSPHATE ISOMERASE GLYCOSOMAL Source (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKSGSPDSLSELIDLFNSTSINHDVQCVVA STFVHLAMTKERLSHPKFVIAAQNAGNADALASLKDFGVN WIVLGHSERRWYYGETNEIVADKVAAAVASGFMVIACIGE TLQERESGRTAVVVLTQIAAIAKKLKKADWAKVVIAYEPV WAIGTGKVLTPQQAQEAHALIRSWVSSKIGADVAGELRIL YGGSVNGKNARTLYQQRDVNGFLVGGASLKPEFVDIIKAT Q Description Functional site 1) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 2) chain A residue 13 type sequence K description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 3) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 4) chain A residue 167 type sequence E description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 5) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 6) chain A residue 172 type sequence I description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 7) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 8) chain A residue 212 type sequence G description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 9) chain A residue 213 type sequence S description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 10) chain A residue 234 type sequence G description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 11) chain A residue 235 type sequence G description BINDING SITE FOR RESIDUE PGA A1251 source : AC1 12) chain A residue 52 type sequence K description BINDING SITE FOR RESIDUE CL B1252 source : AC5 13) chain A residue 86 type sequence F description BINDING SITE FOR RESIDUE CL B1252 source : AC5 14) chain A residue 131 type sequence L description BINDING SITE FOR RESIDUE CL A1252 source : AC6 15) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 16) chain A residue 103 type ACT_SITE sequence G description Electrophile source Swiss-Prot : SWS_FT_FI1 17) chain A residue 175 type ACT_SITE sequence G description Proton acceptor source Swiss-Prot : SWS_FT_FI2 18) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 19) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links