eF-site ID 2v2c-A PDB Code 2v2c Chain A click to enlarge Title The A178L mutation in the C-terminal hinge of the flexible loop-6 of triosephosphate isomerase (TIM) induces a more closed conformation of this hinge region in dimeric and monomeric TIM Classification ISOMERASE Compound TRIOSEPHOSPHATE ISOMERASE GLYCOSOMAL Source null (TPIS_TRYBB) Sequence A:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAIGTGKVLTPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPE FVDIIKATQ Description Functional site 1) chain A residue 134 type sequence R description BINDING SITE FOR RESIDUE SO4 A1251 source : AC1 2) chain A residue 156 type sequence K description BINDING SITE FOR RESIDUE SO4 A1251 source : AC1 3) chain A residue 182 type sequence Q description BINDING SITE FOR RESIDUE SO4 A1251 source : AC1 4) chain A residue 32 type sequence S description BINDING SITE FOR RESIDUE SO4 A1252 source : AC2 5) chain A residue 33 type sequence I description BINDING SITE FOR RESIDUE SO4 A1252 source : AC2 6) chain A residue 34 type sequence N description BINDING SITE FOR RESIDUE SO4 A1252 source : AC2 7) chain A residue 35 type sequence H description BINDING SITE FOR RESIDUE SO4 A1252 source : AC2 8) chain A residue 247 type sequence K description BINDING SITE FOR RESIDUE SO4 A1252 source : AC2 9) chain A residue 250 type sequence Q description BINDING SITE FOR RESIDUE SO4 A1252 source : AC2 10) chain A residue 2 type sequence S description BINDING SITE FOR RESIDUE SO4 A1253 source : AC3 11) chain A residue 3 type sequence K description BINDING SITE FOR RESIDUE SO4 A1253 source : AC3 12) chain A residue 11 type sequence N description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 13) chain A residue 13 type sequence K description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 14) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 15) chain A residue 167 type sequence E description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 16) chain A residue 171 type sequence A description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 17) chain A residue 172 type sequence I description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 18) chain A residue 173 type sequence G description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 19) chain A residue 212 type sequence G description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 20) chain A residue 213 type sequence S description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 21) chain A residue 232 type sequence L description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 22) chain A residue 234 type sequence G description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 23) chain A residue 235 type sequence G description BINDING SITE FOR RESIDUE PGA A1254 source : AC4 24) chain A residue 165-175 type prosite sequence AYEPVWAIGTG description TIM_1 Triosephosphate isomerase active site. AYEPVWAIGTG source prosite : PS00171 25) chain A residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 26) chain A residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 27) chain A residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 28) chain A residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links