eF-site ID 2v1a-A
PDB Code 2v1a
Chain A

click to enlarge
Title N- and C-terminal helices of oat LOV2 (404-546) are involved in light-induced signal transduction (room temperature (293K) dark structure of LOV2 (404-546))
Classification TRANSFERASE
Compound NPH1-1
Source Avena sativa (Oat) (O49003_AVESA)
Sequence A:  FLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSR
EEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLIN
YTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRD
AAEREGVMLIKKTAENIDEAAKEL
Description (1)  NPH1-1


Functional site

1) chain A
residue 416
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

2) chain A
residue 418
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

3) chain A
residue 425
type
ligand
sequence N
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

4) chain A
residue 449
type
ligand
sequence N
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

5) chain A
residue 450
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

6) chain A
residue 451
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

7) chain A
residue 453
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

8) chain A
residue 454
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

9) chain A
residue 463
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

10) chain A
residue 470
type
ligand
sequence I
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

11) chain A
residue 480
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

12) chain A
residue 482
type
ligand
sequence N
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

13) chain A
residue 492
type
ligand
sequence N
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

14) chain A
residue 494
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

15) chain A
residue 511
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

16) chain A
residue 513
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

17) chain A
residue 545
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FMN A1547
source : AC1

18) chain A
residue 403
type
ligand
sequence F
description BINDING SITE FOR RESIDUE GOL A1548
source : AC2

19) chain A
residue 404
type
ligand
sequence L
description BINDING SITE FOR RESIDUE GOL A1548
source : AC2

20) chain A
residue 525
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A1548
source : AC2

21) chain A
residue 526
type
ligand
sequence R
description BINDING SITE FOR RESIDUE GOL A1548
source : AC2

22) chain A
residue 477
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GOL A1549
source : AC3

23) chain A
residue 479
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE GOL A1549
source : AC3

24) chain A
residue 503
type
ligand
sequence K
description BINDING SITE FOR RESIDUE GOL A1549
source : AC3

25) chain A
residue 519
type
ligand
sequence H
description BINDING SITE FOR RESIDUE GOL A1549
source : AC3

26) chain A
residue 525
type
ligand
sequence E
description BINDING SITE FOR RESIDUE GOL A1549
source : AC3

27) chain A
residue 403-406
type binding
ligand GOL: GLYCEROL
sequence FLAT
description GLYCEROL binding site
source pdb_hetatom : GOL_2v1a_A_1548

28) chain A
residue 416
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence V
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

29) chain A
residue 418
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence T
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

30) chain A
residue 425
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence N
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

31) chain A
residue 449-451
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence NCR
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

32) chain A
residue 453-454
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence LQ
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

33) chain A
residue 460
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence R
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

34) chain A
residue 463
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence V
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

35) chain A
residue 466-467
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence IR
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

36) chain A
residue 470
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence I
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

37) chain A
residue 480
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence L
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

38) chain A
residue 482
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence N
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

39) chain A
residue 492
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence N
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

40) chain A
residue 494
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence F
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

41) chain A
residue 496
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence L
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

42) chain A
residue 509-511
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence FIG
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

43) chain A
residue 513
type binding
ligand FMN: FLAVIN MONONUCLEOTIDE
sequence Q
description FLAVIN MONONUCLEOTIDE binding site
source pdb_hetatom : FMN_2v1a_A_1547

44) chain A
residue 477-479
type binding
ligand GOL: GLYCEROL
sequence TVQ
description GLYCEROL binding site
source pdb_hetatom : GOL_2v1a_A_1549

45) chain A
residue 493
type binding
ligand GOL: GLYCEROL
sequence L
description GLYCEROL binding site
source pdb_hetatom : GOL_2v1a_A_1549

46) chain A
residue 519-520
type binding
ligand GOL: GLYCEROL
sequence HV
description GLYCEROL binding site
source pdb_hetatom : GOL_2v1a_A_1549

47) chain A
residue 525
type binding
ligand GOL: GLYCEROL
sequence E
description GLYCEROL binding site
source pdb_hetatom : GOL_2v1a_A_1549


Display surface

Download
Links