eF-site ID 2v0t-D PDB Code 2v0t Chain D click to enlarge Title The A178L mutation in the C-terminal hinge of the flexible loop-6 of triosephosphate isomerase (TIM) induces a more closed conformation of this hinge region in dimeric and monomeric TIM Classification ISOMERASE Compound TRIOSEPHOSPHATE ISOMERASE GLYCOSOMAL Source (TPIS_TRYBB) Sequence D:  SKPQPIAAANWKCNGSQQSLSELIDLFNSTSINHDVQCVV ASTFVHLAMTKERLSHPKFVIAAQNAIAKSGAFTGEVSLP ILKDFGVNWIVLGHSERRAYYGETNEIVADKVAAAVASGF MVIACIGETLQERESGRTAVVVLTQIAAIAKKLKKADWAK VVIAYEPVWAIGTGKVLTPQQAQEAHALIRSWVSSKIGAD VAGELRILYGGSVNGKNARTLYQQRDVNGFLVGGASLKPE FVDIIKATQ Description Functional site 1) chain D residue 213 type sequence S description BINDING SITE FOR RESIDUE SO4 D1251 source : AC4 2) chain D residue 234 type sequence G description BINDING SITE FOR RESIDUE SO4 D1251 source : AC4 3) chain D residue 235 type sequence G description BINDING SITE FOR RESIDUE SO4 D1251 source : AC4 4) chain D residue 29 type sequence N description BINDING SITE FOR RESIDUE EPE D1252 source : BC3 5) chain D residue 31 type sequence T description BINDING SITE FOR RESIDUE EPE D1252 source : BC3 6) chain D residue 32 type sequence S description BINDING SITE FOR RESIDUE EPE D1252 source : BC3 7) chain D residue 33 type sequence I description BINDING SITE FOR RESIDUE EPE D1252 source : BC3 8) chain D residue 57 type sequence H description BINDING SITE FOR RESIDUE EPE D1252 source : BC3 9) chain D residue 59 type sequence K description BINDING SITE FOR RESIDUE EPE D1252 source : BC3 10) chain D residue 95 type ACT_SITE sequence H description Electrophile source Swiss-Prot : SWS_FT_FI1 11) chain D residue 167 type ACT_SITE sequence E description Proton acceptor source Swiss-Prot : SWS_FT_FI2 12) chain D residue 11 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI3 13) chain D residue 13 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links