eF-site ID 2v08-AB PDB Code 2v08 Chain A, B click to enlarge Title Structure of wild-type Phormidium laminosum cytochrome c6 Classification PHOTOSYNTHESIS Compound CYTOCHROME C6 Source (2V08) Sequence A:  DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGM NSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQA EKGW B:  DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGM NSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQA EKGW Description Functional site 1) chain A residue 14 type sequence N description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 2) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 3) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 4) chain A residue 19 type sequence H description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 5) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 6) chain A residue 26 type sequence V description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 7) chain A residue 27 type sequence N description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 8) chain A residue 30 type sequence K description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 9) chain A residue 31 type sequence T description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 10) chain A residue 32 type sequence L description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 11) chain A residue 40 type sequence F description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 12) chain A residue 42 type sequence M description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 13) chain A residue 51 type sequence Q description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 14) chain A residue 52 type sequence V description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 15) chain A residue 56 type sequence K description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 16) chain A residue 57 type sequence A description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 17) chain A residue 58 type sequence G description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 18) chain A residue 59 type sequence M description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 19) chain A residue 60 type sequence P description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 20) chain B residue 17 type sequence A description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 21) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 22) chain A residue 25 type sequence L description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 23) chain A residue 25 type sequence L description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 24) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 25) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 26) chain A residue 77 type sequence Y description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 27) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 28) chain A residue 86 type sequence W description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 29) chain B residue 14 type sequence N description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 30) chain B residue 15 type sequence C description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 31) chain B residue 18 type sequence C description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 32) chain B residue 19 type sequence H description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 33) chain B residue 24 type sequence N description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 34) chain B residue 27 type sequence N description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 35) chain B residue 30 type sequence K description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 36) chain B residue 31 type sequence T description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 37) chain B residue 32 type sequence L description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 38) chain B residue 40 type sequence F description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 39) chain B residue 42 type sequence M description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 40) chain B residue 51 type sequence Q description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 41) chain B residue 56 type sequence K description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 42) chain B residue 59 type sequence M description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 43) chain B residue 62 type sequence F description BINDING SITE FOR RESIDUE HEM B 1087 source : AC4 44) chain B residue 24 type sequence N description BINDING SITE FOR RESIDUE IMD B 1088 source : AC5 45) chain B residue 25 type sequence L description BINDING SITE FOR RESIDUE IMD B 1088 source : AC5 46) chain B residue 25 type sequence L description BINDING SITE FOR RESIDUE IMD B 1088 source : AC5 47) chain B residue 35 type sequence E description BINDING SITE FOR RESIDUE IMD B 1089 source : AC6 48) chain B residue 77 type sequence Y description BINDING SITE FOR RESIDUE IMD B 1089 source : AC6 49) chain B residue 81 type sequence Q description BINDING SITE FOR RESIDUE IMD B 1089 source : AC6 50) chain B residue 86 type sequence W description BINDING SITE FOR RESIDUE IMD B 1089 source : AC6 51) chain A residue 27 type sequence N description BINDING SITE FOR RESIDUE ZN A 1090 source : AC7 52) chain A residue 29 type sequence E description BINDING SITE FOR RESIDUE ZN A 1090 source : AC7 53) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE ZN A 1092 source : BC2 54) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE ZN A 1092 source : BC2 55) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE ZN A 1092 source : BC2 56) chain B residue 27 type sequence N description BINDING SITE FOR RESIDUE ZN B 1092 source : BC4 57) chain B residue 29 type sequence E description BINDING SITE FOR RESIDUE ZN B 1092 source : BC4 58) chain B residue 35 type sequence E description BINDING SITE FOR RESIDUE ZN B 1093 source : BC5 59) chain B residue 86 type sequence W description BINDING SITE FOR RESIDUE ZN B 1093 source : BC5 60) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE ZN A 1094 source : BC6 61) chain A residue 86 type sequence W description BINDING SITE FOR RESIDUE ZN A 1094 source : BC6 62) chain A residue 21 type sequence G description BINDING SITE FOR RESIDUE CL A 1095 source : BC7 63) chain A residue 31 type sequence T description BINDING SITE FOR RESIDUE CL A 1095 source : BC7 64) chain A residue 11 type sequence F description BINDING SITE FOR RESIDUE CL A 1096 source : BC8 65) chain A residue 21 type sequence G description BINDING SITE FOR RESIDUE CL A 1096 source : BC8 66) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE CL A 1097 source : BC9 67) chain A residue 36 type sequence A description BINDING SITE FOR RESIDUE CL A 1097 source : BC9 68) chain A residue 39 type sequence K description BINDING SITE FOR RESIDUE CL A 1097 source : BC9

Display surface Download Links