eF-site ID 2v08-A PDB Code 2v08 Chain A click to enlarge Title Structure of wild-type Phormidium laminosum cytochrome c6 Classification PHOTOSYNTHESIS Compound CYTOCHROME C6 Source (2V08) Sequence A:  DLATGAKVFSANCAACHAGGINLVNAEKTLKKEALEKFGM NSIVAITTQVTNGKAGMPAFKGRLTDDQIAAVAAYVLDQA EKGW Description Functional site 1) chain A residue 14 type sequence N description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 2) chain A residue 15 type sequence C description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 3) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 4) chain A residue 19 type sequence H description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 5) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 6) chain A residue 26 type sequence V description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 7) chain A residue 27 type sequence N description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 8) chain A residue 30 type sequence K description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 9) chain A residue 31 type sequence T description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 10) chain A residue 32 type sequence L description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 11) chain A residue 40 type sequence F description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 12) chain A residue 42 type sequence M description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 13) chain A residue 51 type sequence Q description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 14) chain A residue 52 type sequence V description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 15) chain A residue 56 type sequence K description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 16) chain A residue 57 type sequence A description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 17) chain A residue 58 type sequence G description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 18) chain A residue 59 type sequence M description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 19) chain A residue 60 type sequence P description BINDING SITE FOR RESIDUE HEM A 1087 source : AC1 20) chain A residue 24 type sequence N description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 21) chain A residue 25 type sequence L description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 22) chain A residue 25 type sequence L description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 23) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE IMD A 1088 source : AC2 24) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 25) chain A residue 77 type sequence Y description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 26) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 27) chain A residue 86 type sequence W description BINDING SITE FOR RESIDUE IMD A 1089 source : AC3 28) chain A residue 27 type sequence N description BINDING SITE FOR RESIDUE ZN A 1090 source : AC7 29) chain A residue 29 type sequence E description BINDING SITE FOR RESIDUE ZN A 1090 source : AC7 30) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE ZN A 1092 source : BC2 31) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE ZN A 1092 source : BC2 32) chain A residue 68 type sequence D description BINDING SITE FOR RESIDUE ZN A 1092 source : BC2 33) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE ZN A 1094 source : BC6 34) chain A residue 86 type sequence W description BINDING SITE FOR RESIDUE ZN A 1094 source : BC6 35) chain A residue 21 type sequence G description BINDING SITE FOR RESIDUE CL A 1095 source : BC7 36) chain A residue 31 type sequence T description BINDING SITE FOR RESIDUE CL A 1095 source : BC7 37) chain A residue 11 type sequence F description BINDING SITE FOR RESIDUE CL A 1096 source : BC8 38) chain A residue 21 type sequence G description BINDING SITE FOR RESIDUE CL A 1096 source : BC8 39) chain A residue 35 type sequence E description BINDING SITE FOR RESIDUE CL A 1097 source : BC9 40) chain A residue 36 type sequence A description BINDING SITE FOR RESIDUE CL A 1097 source : BC9 41) chain A residue 39 type sequence K description BINDING SITE FOR RESIDUE CL A 1097 source : BC9

Display surface Download Links