eF-site ID 2uzk-A PDB Code 2uzk Chain A click to enlarge Title Crystal structure of the human FOXO3a-DBD bound to DNA Classification TRANSCRIPTION Compound FORKHEAD BOX PROTEIN O3A Source Homo sapiens (Human) (2UZK) Sequence A:  MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKD KGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWII NPDGGKSGKAPRRRAVS Description Functional site 1) chain A residue 179 type MOD_RES sequence T description Phosphothreonine; by AMPK => ECO:0000269|PubMed:17711846 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 209 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:16751106 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 206-212 type prosite sequence WKNSIRH description FORK_HEAD_2 Fork head domain signature 2. WKNSIRH source prosite : PS00658 4) chain A residue 215 type MOD_RES sequence S description Phosphoserine; by MAPKAPK5 => ECO:0000269|PubMed:21329882 source Swiss-Prot : SWS_FT_FI3 5) chain A residue 230 type MOD_RES sequence K description N6-methyllysine => ECO:0000269|PubMed:22820736 source Swiss-Prot : SWS_FT_FI4 6) chain A residue 242 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9WVH4 source Swiss-Prot : SWS_FT_FI5 7) chain A residue 253 type MOD_RES sequence S description Phosphoserine; by PKB/AKT1 and MAPKAPK5 => ECO:0000269|PubMed:10102273, ECO:0000269|PubMed:21329882, ECO:0000269|PubMed:30513302 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links