eF-site ID 2uua-Q
PDB Code 2uua
Chain Q

click to enlarge
Title Structure of the Thermus thermophilus 30S ribosomal subunit complexed with a Valine-ASL with cmo5U in position 34 bound to an mRNA with a GUC-codon in the A-site and paromomycin.
Classification RIBOSOME
Compound 16S RRNA
Source ORGANISM_SCIENTIFIC: THERMUS THERMOPHILUS;
Sequence Q:  PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKK
YLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGR
MDLVEKYLIRRQNYESLSKRGGKA
Description (1)  30S RIBOSOMAL PROTEIN S2, 30S RIBOSOMAL PROTEIN S3, 30S RIBOSOMAL PROTEIN S4, 30S RIBOSOMAL PROTEIN S5, 30S RIBOSOMAL PROTEIN S6, 30S RIBOSOMAL PROTEIN S7, 30S RIBOSOMAL PROTEIN S8, 30S RIBOSOMAL PROTEIN S9, 30S RIBOSOMAL PROTEIN S10, 30S RIBOSOMAL PROTEIN S11, 30S RIBOSOMAL PROTEIN S12, 30S RIBOSOMAL PROTEIN S13, 30S RIBOSOMAL PROTEIN S14, 30S RIBOSOMAL PROTEIN S15, 30S RIBOSOMAL PROTEIN S16, 30S RIBOSOMAL PROTEIN S17, 30S RIBOSOMAL PROTEIN S18, 30S RIBOSOMAL PROTEIN S19, 30S RIBOSOMAL PROTEIN S20, 30S RIBOSOMAL PROTEIN THX/RNA Complex, PAROMOMYCIN


Functional site

1) chain Q
residue 32
type
ligand
sequence Y
description binding site for residue MG A 1723
source : AM9

2) chain Q
residue 39
type
ligand
sequence S
description binding site for residue MG A 1739
source : AO7

3) chain Q
residue 65
type
ligand
sequence I
description binding site for residue MG A 1782
source : AT5

4) chain Q
residue 13
type
ligand
sequence D
description binding site for residue MG Q 201
source : AU8

5) chain Q
residue 15
type
ligand
sequence M
description binding site for residue MG Q 201
source : AU8

6) chain Q
residue 49
type
ligand
sequence E
description binding site for residue MG Q 201
source : AU8


Display surface

Download
Links