eF-site ID 2uua-L PDB Code 2uua Chain L click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit complexed with a Valine-ASL with cmo5U in position 34 bound to an mRNA with a GUC-codon in the A-site and paromomycin. Classification RIBOSOME Compound 16S RRNA Source ORGANISM_SCIENTIFIC: THERMUS THERMOPHILUS; Sequence L:  PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVT PKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVL IRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKK PKEAA Description Functional site 1) chain L residue 48 type sequence P description binding site for residue MG A 1709 source : AL5 2) chain L residue 49 type sequence N description binding site for residue MG A 1709 source : AL5 3) chain L residue 44 type sequence T description binding site for residue MG A 1710 source : AL6 4) chain L residue 20 type sequence K description binding site for residue MG A 1722 source : AM8 5) chain L residue 15 type sequence R description binding site for residue MG A 1723 source : AM9 6) chain L residue 48 type sequence P description binding site for residue MG A 1783 source : AT6 7) chain L residue 46-53 type prosite sequence KKPNSALR description RIBOSOMAL_S12 Ribosomal protein S12 signature. KkPNSAlR source prosite : PS00055

Display surface Download Links