eF-site ID 2uua-BCDEFGHIJKLMNOPQRSTU PDB Code 2uua Chain B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U click to enlarge Title Structure of the Thermus thermophilus 30S ribosomal subunit complexed with a Valine-ASL with cmo5U in position 34 bound to an mRNA with a GUC-codon in the A-site and paromomycin. Classification RIBOSOME Compound 16S RRNA Source ORGANISM_SCIENTIFIC: THERMUS THERMOPHILUS; Sequence B:  VKELLEAGVHFGHERKRWNPKFARYIYAERNGIHIIDLQK TMEELERTFRFIEDLAMRGGTILFVGTKKQAQDIVRMEAE RAGMPYVNQRWLGGMLTNFKTISQRVHRLEELEALFASPE IEERPKKEQVRLKHELERLQKYLSGFRLLKRLPDAIFVVD PTKEAIAVREARKLFIPVIALADTDSDPDLVDYIIPGNDD AIRSIQLILSRAVDLIIQARGGVVEPSPSYALVQE C:  GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRG LLEKELYSAGLARVDIERAADNVAVTVHVAKPGVVIGRGG ERIRVLREELAKLTGKNVALNVQEVQNPNLSAPLVAQRVA EQIERRFAVRRAIKQAVQRVMESGAKGAKVIVSGRIGGAE QARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY IFLGEVI D:  GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPG QHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEE ASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLV RHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQN LEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ LVIEFYSR E:  DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLG FGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEF GASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELG SRNPINIAYATMEALRQLRTKADVERLRKGE F:  MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKV EELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELR IRDNVRRVMVVKSQEPFLANA G:  ARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAAR IFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVG GANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIA HELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW H:  MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILA REGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVI HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLT DREARKLGVGGELICEVW I:  EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLV RAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGI ARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARR APQYSKR J:  KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPT RVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTI EQLMTLDLPTGVEIEIKTV K:  KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGY KGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAG REQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS L:  PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVT PKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVL IRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKK PKEAA M:  ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINP ATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRL MDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK KAPRK N:  ARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCR ICLRELAHKGQLPGVRKASW O:  PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSE HLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRAL IEKLGIRG P:  MVKIRLARFGSKHNPHYRIVVTDARRKRDGKYIEKIGYYD PRKTTPDWLKVDVERARYWLSVGAQPTDTARRLLRQAGVF RQEA Q:  PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKK YLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGR MDLVEKYLIRRQNYESLSKRGGKA R:  PSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRR TGLSAKEQRILAKTIKRARILGLLPFTEKLVRK S:  PRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIV PEMVGHTIAVYNGKQHVPVYITENMVGHKLGEFAPTRTYR G T:  RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEG KAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRK VRQLLEAAGAPLIGGGLSA U:  GKGDRRTRRGKIWRGTYGKYRPRKK Description Functional site 1) chain N residue 2 type sequence A description binding site for residue MG A 1610 source : AC8 2) chain T residue 83 type sequence R description binding site for residue MG A 1611 source : AC9 3) chain T residue 35 type sequence T description binding site for residue MG A 1666 source : AH5 4) chain U residue 5 type sequence D description binding site for residue MG A 1698 source : AK6 5) chain L residue 48 type sequence P description binding site for residue MG A 1709 source : AL5 6) chain L residue 49 type sequence N description binding site for residue MG A 1709 source : AL5 7) chain L residue 44 type sequence T description binding site for residue MG A 1710 source : AL6 8) chain L residue 20 type sequence K description binding site for residue MG A 1722 source : AM8 9) chain L residue 15 type sequence R description binding site for residue MG A 1723 source : AM9 10) chain Q residue 32 type sequence Y description binding site for residue MG A 1723 source : AM9 11) chain Q residue 39 type sequence S description binding site for residue MG A 1739 source : AO7 12) chain M residue 101 type sequence Q description binding site for residue MG A 1751 source : AQ1 13) chain E residue 27 type sequence R description binding site for residue MG A 1753 source : AQ3 14) chain U residue 3 type sequence K description binding site for residue K A 1775 source : AS7 15) chain G residue 78 type sequence R description binding site for residue K A 1778 source : AT1 16) chain M residue 20 type sequence T description binding site for residue MG A 1781 source : AT4 17) chain M residue 22 type sequence I description binding site for residue MG A 1781 source : AT4 18) chain M residue 23 type sequence Y description binding site for residue MG A 1781 source : AT4 19) chain M residue 25 type sequence I description binding site for residue MG A 1781 source : AT4 20) chain Q residue 65 type sequence I description binding site for residue MG A 1782 source : AT5 21) chain L residue 48 type sequence P description binding site for residue MG A 1783 source : AT6 22) chain B residue 20 type sequence E description binding site for residue MG B 301 source : AT7 23) chain B residue 166 type sequence D description binding site for residue MG B 301 source : AT7 24) chain B residue 189 type sequence D description binding site for residue MG B 301 source : AT7 25) chain B residue 191 type sequence D description binding site for residue MG B 301 source : AT7 26) chain B residue 205 type sequence D description binding site for residue MG B 301 source : AT7 27) chain D residue 9 type sequence C description binding site for residue ZN D 301 source : AT8 28) chain D residue 12 type sequence C description binding site for residue ZN D 301 source : AT8 29) chain D residue 19 type sequence L description binding site for residue ZN D 301 source : AT8 30) chain D residue 26 type sequence C description binding site for residue ZN D 301 source : AT8 31) chain D residue 31 type sequence C description binding site for residue ZN D 301 source : AT8 32) chain D residue 82 type sequence A description binding site for residue MG D 302 source : AT9 33) chain D residue 83 type sequence S description binding site for residue MG D 302 source : AT9 34) chain D residue 85 type sequence K description binding site for residue MG D 302 source : AT9 35) chain D residue 87 type sequence G description binding site for residue MG D 302 source : AT9 36) chain D residue 89 type sequence T description binding site for residue MG D 302 source : AT9 37) chain E residue 13 type sequence I description binding site for residue MG E 202 source : AU1 38) chain E residue 83 type sequence E description binding site for residue K E 203 source : AU2 39) chain F residue 80 type sequence R description binding site for residue MG F 201 source : AU3 40) chain F residue 82 type sequence R description binding site for residue MG F 201 source : AU3 41) chain F residue 85 type sequence V description binding site for residue MG F 201 source : AU3 42) chain G residue 35 type sequence K description binding site for residue MG G 201 source : AU4 43) chain G residue 37 type sequence N description binding site for residue MG G 201 source : AU4 44) chain G residue 38 type sequence L description binding site for residue MG G 201 source : AU4 45) chain H residue 7 type sequence A description binding site for residue MG H 201 source : AU5 46) chain H residue 11 type sequence T description binding site for residue MG H 201 source : AU5 47) chain H residue 14 type sequence R description binding site for residue MG H 201 source : AU5 48) chain H residue 14 type sequence R description binding site for residue MG H 202 source : AU6 49) chain H residue 82 type sequence H description binding site for residue MG H 202 source : AU6 50) chain H residue 83 type sequence I description binding site for residue MG H 202 source : AU6 51) chain N residue 24 type sequence C description binding site for residue ZN N 101 source : AU7 52) chain N residue 27 type sequence C description binding site for residue ZN N 101 source : AU7 53) chain N residue 40 type sequence C description binding site for residue ZN N 101 source : AU7 54) chain N residue 43 type sequence C description binding site for residue ZN N 101 source : AU7 55) chain Q residue 13 type sequence D description binding site for residue MG Q 201 source : AU8 56) chain Q residue 15 type sequence M description binding site for residue MG Q 201 source : AU8 57) chain Q residue 49 type sequence E description binding site for residue MG Q 201 source : AU8 58) chain G residue 20-46 type prosite sequence DVLVTAFINKIMRDGKKNLAARIFYDA description RIBOSOMAL_S7 Ribosomal protein S7 signature. DvLvtaFInkimrdGKKnlaarIFydA source prosite : PS00052 59) chain H residue 108-125 type prosite sequence GIAILSTSKGVLTDREAR description RIBOSOMAL_S8 Ribosomal protein S8 signature. GiaILSTSkGVLtdreAR source prosite : PS00053 60) chain K residue 95-117 type prosite sequence IRALQASGLQVKSIVDDTPVPHN description RIBOSOMAL_S11 Ribosomal protein S11 signature. IrALqaS.GLqVksivDdTPvPHN source prosite : PS00054 61) chain L residue 46-53 type prosite sequence KKPNSALR description RIBOSOMAL_S12 Ribosomal protein S12 signature. KkPNSAlR source prosite : PS00055 62) chain Q residue 54-66 type prosite sequence GDVVEIIESRPIS description RIBOSOMAL_S17 Ribosomal protein S17 signature. GDvVeIiEsRPIS source prosite : PS00056 63) chain R residue 32-55 type prosite sequence RDYRNVEVLKRFLSETGKILPRRR description RIBOSOMAL_S18 Ribosomal protein S18 signature. RDYrn.VevLkrFLSEt.GKIlprRR source prosite : PS00057 64) chain R residue 66-81 type prosite sequence LAKTIKRARILGLLPF description ALDOKETO_REDUCTASE_3 Aldo/keto reductase family putative active site signature. LAKTIKraRIlGLlPF source prosite : PS00063 65) chain S residue 53-77 type prosite sequence NGKQHVPVYITENMVGHKLGEFAPT description RIBOSOMAL_S19 Ribosomal protein S19 signature. NGKqhvpvyItenmVGhkLGEFapT source prosite : PS00323 66) chain I residue 67-85 type prosite sequence GGGKSGQIDAIKLGIARAL description RIBOSOMAL_S9 Ribosomal protein S9 signature. GGGksGQidAiklGiARAL source prosite : PS00360 67) chain J residue 27-42 type prosite sequence ARRSGAQVSGPIPLPT description RIBOSOMAL_S10 Ribosomal protein S10 signature. ArrsGAqvsGPIpLPT source prosite : PS00361 68) chain O residue 39-69 type prosite sequence LSEHLKVHKKDHHSHRGLLMMVGQRRRLLRY description RIBOSOMAL_S15 Ribosomal protein S15 signature. LseHLkvhKkDhhShrgLlmMvgqrrrLlrY source prosite : PS00362 69) chain N residue 23-45 type prosite sequence RCVRCGRARSVYRFFGLCRICLR description RIBOSOMAL_S14 Ribosomal protein S14 signature. R.CvrcgrarsvyrfFGLCRiCLR source prosite : PS00527 70) chain C residue 163-197 type prosite sequence ARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLG description RIBOSOMAL_S3 Ribosomal protein S3 signature. ARtewaaqGrVplHt..LranIDygfalarTtyGvlG source prosite : PS00548 71) chain E residue 23-55 type prosite sequence GRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAV description RIBOSOMAL_S5 Ribosomal protein S5 signature. GRrfrFgAlvVVGDrq.GrVGlGfgkap.EVpl.AV source prosite : PS00585 72) chain D residue 97-121 type prosite sequence LESRLDNVVYRLGFAVSRRQARQLV description RIBOSOMAL_S4 Ribosomal protein S4 signature. LEsRLdnvVYRlgfAvSrrqARqLV source prosite : PS00632 73) chain M residue 88-101 type prosite sequence RGLRHRRGLPVRGQ description RIBOSOMAL_S13_1 Ribosomal protein S13 signature. RGlRHrrGlpVRGQ source prosite : PS00646 74) chain B residue 7-18 type prosite sequence VKELLEAGVHFG description RIBOSOMAL_S2_1 Ribosomal protein S2 signature 1. VkELLEAGVHFG source prosite : PS00962 75) chain F residue 44-53 type prosite sequence GLRRLAYPIA description RIBOSOMAL_S6 Ribosomal protein S6 signature. GlRRLAYpIA source prosite : PS01048 76) chain N residue 25 type BINDING sequence V description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 77) chain N residue 28 type BINDING sequence G description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 78) chain N residue 41 type BINDING sequence R description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1 79) chain N residue 44 type BINDING sequence L description BINDING => ECO:0000269|PubMed:11866529 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links