eF-site ID 2tir-A PDB Code 2tir Chain A click to enlarge Title CRYSTAL STRUCTURE ANALYSIS OF A MUTANT ESCHERICHIA COLI THIOREDOXIN IN WHICH LYSINE 36 IS REPLACED BY GLUTAMIC ACID Classification ELECTRON TRANSPORT Compound THIOREDOXIN Source Escherichia coli (strain K12) (THIO_ECOLI) Sequence A:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCEMIAP ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA Description (1)  THIOREDOXIN MUTANT WITH LYS 36 REPLACED BY GLU (K36E) Functional site 1) chain A residue 1 type sequence S description BINDING SITE FOR RESIDUE CU A 109 source : AC1 2) chain A residue 2 type sequence D description BINDING SITE FOR RESIDUE CU A 109 source : AC1 3) chain A residue 10 type sequence D description BINDING SITE FOR RESIDUE CU A 109 source : AC1 4) chain A residue 24-42 type prosite sequence LVDFWAEWCGPCEMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCEmIapiL source prosite : PS00194 5) chain A residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 6) chain A residue 36 type ACT_SITE sequence E description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 8) chain A residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 9) chain A residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 10) chain A residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links