eF-site ID 2rnw_16-AB
PDB Code 2rnw
Model 16
Chain A, B

click to enlarge
Title The Structural Basis for Site-Specific Lysine-Acetylated Histone Recognition by the Bromodomains of the Human Transcriptional Co-Activators PCAf and CBP
Classification TRANSFERASE/NUCLEAR PROTEIN
Compound Histone acetyltransferase PCAF
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (H3_YEAST)
Sequence A:  GSHMSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKR
TEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQR
VFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
B:  ARTKQTARXSTGGKA
Description (1)  Histone acetyltransferase PCAF (E.C.2.3.1.48), Histone H3


Functional site

1) chain A
residue 745-802
type prosite
ligand
sequence AWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVS
KKLFMADLQRVFTNCKEY
description Bromodomain signature.[STANVFHG]-x(2)-[FAS]-x(4)-[DNSPAKT]-x(0,7)-[DENQTFG]-Y-[HFYLRKT]-x(2)-[LIVMFY]-x(3)-[LIVM]-x(4)-[LIVM]-x(6,10)-Y-x(12,13)-[LIVM]-x(2)-N-[SACF]-x(2)-[FY].
source prosite : PS00633


Display surface

Download
Links