eF-site ID 2rjp-A PDB Code 2rjp Chain A click to enlarge Title Crystal structure of ADAMTS4 with inhibitor bound Classification HYDROLASE Compound ADAMTS-4 Source Homo sapiens (Human) (ATS4_HUMAN) Sequence A:  ASLSRFVETLVVADDKMAAFHGAGLKRYLLTVMAAAAKAF KHPSIRNPVSLVVTRLVILEGPQVGPSAAQTLRSFCAWQR GLNTPEDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGT VCDPARSCAIVEDDGLQSAFTAAHQLGHVFNMLHDNSKPC ISLNGPLSTSRHVMAPVMAHVDPEEPWSPCSARFITDFLD NGYGHCLLDKPEAPLHLPVTFPGKDYDADRQCQLTFGPDS RHCPQLPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGP AQACMGGRCLH Description Functional site 1) chain A residue 361 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 365 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 371 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 320 type sequence D description BINDING SITE FOR RESIDUE CA A 2 source : AC2 5) chain A residue 321 type sequence L description BINDING SITE FOR RESIDUE CA A 2 source : AC2 6) chain A residue 327 type sequence C description BINDING SITE FOR RESIDUE CA A 2 source : AC2 7) chain A residue 329 type sequence T description BINDING SITE FOR RESIDUE CA A 2 source : AC2 8) chain A residue 349 type sequence E description BINDING SITE FOR RESIDUE CA A 2 source : AC2 9) chain A residue 221 type sequence E description BINDING SITE FOR RESIDUE CA A 3 source : AC3 10) chain A residue 304 type sequence D description BINDING SITE FOR RESIDUE CA A 3 source : AC3 11) chain A residue 311 type sequence D description BINDING SITE FOR RESIDUE CA A 3 source : AC3 12) chain A residue 423 type sequence C description BINDING SITE FOR RESIDUE CA A 3 source : AC3 13) chain A residue 426 type sequence D description BINDING SITE FOR RESIDUE CA A 3 source : AC3 14) chain A residue 221 type sequence E description BINDING SITE FOR RESIDUE CA A 4 source : AC4 15) chain A residue 304 type sequence D description BINDING SITE FOR RESIDUE CA A 4 source : AC4 16) chain A residue 426 type sequence D description BINDING SITE FOR RESIDUE CA A 4 source : AC4 17) chain A residue 252 type sequence A description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 18) chain A residue 329 type sequence T description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 19) chain A residue 330 type sequence L description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 20) chain A residue 331 type sequence G description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 21) chain A residue 332 type sequence M description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 22) chain A residue 357 type sequence F description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 23) chain A residue 361 type sequence H description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 24) chain A residue 362 type sequence Q description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 25) chain A residue 365 type sequence H description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 26) chain A residue 371 type sequence H description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 27) chain A residue 390 type sequence V description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 28) chain A residue 392 type sequence A description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 29) chain A residue 393 type sequence P description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 30) chain A residue 394 type sequence V description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 31) chain A residue 398 type sequence V description BINDING SITE FOR RESIDUE 886 A 510 source : CC2 32) chain A residue 361 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 365 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 371 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 362 type ACT_SITE sequence Q description ACT_SITE => ECO:0000255|PROSITE-ProRule:PRU00276, ECO:0000255|PROSITE-ProRule:PRU10095, ECO:0000269|PubMed:18042673 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links