eF-site ID 2rfi-ABPQ PDB Code 2rfi Chain A, B, P, Q click to enlarge Title Crystal structure of catalytic domain of human euchromatic histone methyltransferase 1 in complex with SAH and dimethylated H3K9 peptide Classification TRANSFERASE Compound Histone-lysine N-methyltransferase, H3 lysine-9 specific 5 Source null (2RFI) Sequence A:  VERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNC VTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYD KDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLR ARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEA DVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEP NLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGER FWDIKGKLFSCRCGSPKCRHS B:  IVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTS PMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDG RLLPEFNMAEPPLIFECNHACSCWRNCRNRVVQNGLRARL QLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVR EEDSYLFDLVYCIDARFYGNVSRFINHHCEPNLVPVRVFM AHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLF SCRCGSPKCRHS P:  KQTARXST Q:  TARXST Description Functional site 1) chain A residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 2) chain A residue 1044 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 3) chain A residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 4) chain A residue 1078 type sequence C description BINDING SITE FOR RESIDUE ZN A 501 source : AC1 5) chain A residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 6) chain A residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 7) chain A residue 1080 type sequence C description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 8) chain A residue 1084 type sequence C description BINDING SITE FOR RESIDUE ZN A 502 source : AC2 9) chain A residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 10) chain A residue 1033 type sequence C description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 11) chain A residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 12) chain A residue 1042 type sequence C description BINDING SITE FOR RESIDUE ZN A 503 source : AC3 13) chain A residue 1172 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 14) chain A residue 1225 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 15) chain A residue 1227 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 16) chain A residue 1232 type sequence C description BINDING SITE FOR RESIDUE ZN A 504 source : AC4 17) chain B residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN B 501 source : AC5 18) chain B residue 1044 type sequence C description BINDING SITE FOR RESIDUE ZN B 501 source : AC5 19) chain B residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN B 501 source : AC5 20) chain B residue 1078 type sequence C description BINDING SITE FOR RESIDUE ZN B 501 source : AC5 21) chain B residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN B 502 source : AC6 22) chain B residue 1074 type sequence C description BINDING SITE FOR RESIDUE ZN B 502 source : AC6 23) chain B residue 1080 type sequence C description BINDING SITE FOR RESIDUE ZN B 502 source : AC6 24) chain B residue 1084 type sequence C description BINDING SITE FOR RESIDUE ZN B 502 source : AC6 25) chain B residue 1031 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC7 26) chain B residue 1033 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC7 27) chain B residue 1037 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC7 28) chain B residue 1042 type sequence C description BINDING SITE FOR RESIDUE ZN B 503 source : AC7 29) chain B residue 1172 type sequence C description BINDING SITE FOR RESIDUE ZN B 504 source : AC8 30) chain B residue 1225 type sequence C description BINDING SITE FOR RESIDUE ZN B 504 source : AC8 31) chain B residue 1227 type sequence C description BINDING SITE FOR RESIDUE ZN B 504 source : AC8 32) chain B residue 1232 type sequence C description BINDING SITE FOR RESIDUE ZN B 504 source : AC8 33) chain A residue 1105 type sequence M description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 34) chain A residue 1107 type sequence W description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 35) chain A residue 1141 type sequence S description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 36) chain A residue 1142 type sequence Y description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 37) chain A residue 1166 type sequence R description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 38) chain A residue 1167 type sequence F description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 39) chain A residue 1169 type sequence N description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 40) chain A residue 1170 type sequence H description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 41) chain A residue 1211 type sequence Y description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 42) chain A residue 1215 type sequence F description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 43) chain A residue 1223 type sequence F description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 44) chain A residue 1225 type sequence C description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 45) chain A residue 1226 type sequence R description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 46) chain P residue 7 type sequence X description BINDING SITE FOR RESIDUE SAH A 101 source : AC9 47) chain B residue 1105 type sequence M description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 48) chain B residue 1107 type sequence W description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 49) chain B residue 1166 type sequence R description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 50) chain B residue 1169 type sequence N description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 51) chain B residue 1170 type sequence H description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 52) chain B residue 1211 type sequence Y description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 53) chain B residue 1223 type sequence F description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 54) chain B residue 1224 type sequence S description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 55) chain B residue 1225 type sequence C description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 56) chain B residue 1226 type sequence R description BINDING SITE FOR RESIDUE SAH A 102 source : BC1 57) chain A residue 1062 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 58) chain A residue 1064 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 59) chain A residue 1068 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1 60) chain A residue 1073 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 61) chain A residue 1075 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 62) chain A residue 1105 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 63) chain A residue 1136 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI1 64) chain A residue 1173 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 65) chain A residue 1200 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 66) chain A residue 1203 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 67) chain B residue 1062 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 68) chain B residue 1064 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 69) chain B residue 1068 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI1 70) chain B residue 1073 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 71) chain B residue 1075 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 72) chain B residue 1105 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 73) chain B residue 1109 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI1 74) chain B residue 1111 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI1 75) chain B residue 1115 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 76) chain B residue 1136 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI1 77) chain B residue 1173 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 78) chain B residue 1200 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI1 79) chain B residue 1203 type BINDING sequence A description source Swiss-Prot : SWS_FT_FI1 80) chain A residue 1109 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI1 81) chain A residue 1111 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI1 82) chain A residue 1115 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI1 83) chain A residue 1155 type SITE sequence C description Histone H3K9me binding => ECO:0000269|PubMed:18264113, ECO:0000269|PubMed:20084102 source Swiss-Prot : SWS_FT_FI2 84) chain B residue 1155 type SITE sequence C description Histone H3K9me binding => ECO:0000269|PubMed:18264113, ECO:0000269|PubMed:20084102 source Swiss-Prot : SWS_FT_FI2 85) chain A residue 1004 type MOD_RES sequence P description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 86) chain A residue 1048 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 87) chain B residue 1004 type MOD_RES sequence P description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 88) chain B residue 1048 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links