eF-site ID 2rbn-A PDB Code 2rbn Chain A click to enlarge Title N-phenylglycinonitrile in complex with T4 lysozyme L99A/M102Q Classification HYDROLASE Compound Lysozyme Source Enterobacteria phage T4 (Bacteriophage T4) (LYS_BPT4) Sequence A:  MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLN AAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR NAKLKPVYDSLDAVRRCAAINQVFQMGETGVAGFTNSLRM LQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA YK Description Functional site 1) chain A residue 14 type sequence R description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 2) chain A residue 19 type sequence K description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 3) chain A residue 125 type sequence R description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 4) chain A residue 126 type sequence W description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 5) chain A residue 127 type sequence D description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 6) chain A residue 128 type sequence E description BINDING SITE FOR RESIDUE PO4 A 2001 source : AC1 7) chain A residue 99 type sequence A description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 8) chain A residue 102 type sequence Q description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 9) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 10) chain A residue 117 type sequence S description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 11) chain A residue 118 type sequence L description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 12) chain A residue 121 type sequence L description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 13) chain A residue 153 type sequence F description BINDING SITE FOR RESIDUE 264 A 1001 source : AC2 14) chain A residue 11 type catalytic sequence E description 921 source MCSA : MCSA1 15) chain A residue 20 type catalytic sequence D description 921 source MCSA : MCSA1 16) chain A residue 11 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04110, ECO:0000269|PubMed:3382407, ECO:0000269|PubMed:7831309, ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 20 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_04110, ECO:0000269|PubMed:1892846, ECO:0000269|PubMed:3382407, ECO:0000269|PubMed:7831309, ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 32 type BINDING sequence L description BINDING => ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 104 type BINDING sequence F description BINDING => ECO:0000269|PubMed:8266098 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 117 type BINDING sequence S description BINDING => ECO:0000303|PubMed:7831309 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 132 type BINDING sequence N description BINDING => ECO:0000303|PubMed:7831309 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links