eF-site ID 2r4z-A PDB Code 2r4z Chain A click to enlarge Title Ligand Migration and Binding in The Dimeric Hemoglobin of Scapharca Inaequivalvis: Structure of I25W with CO Classification OXYGEN BINDING Compound Globin-1 Source Anadara inaequivalvis (Inequivalve ark) (Scapharca inaequivalvis) (GLB1_SCAIN) Sequence A:  SVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKV LASKNFGDKYANAWAKLVAVVQAAL Description Functional site 1) chain A residue 78 type sequence Q description BINDING SITE FOR RESIDUE PO4 A 501 source : AC1 2) chain A residue 82 type sequence D description BINDING SITE FOR RESIDUE PO4 A 501 source : AC1 3) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 4) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 5) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 6) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 7) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 8) chain A residue 104 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 9) chain A residue 110 type sequence E description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 10) chain A residue 111 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC2 11) chain A residue 96 type sequence K description BINDING SITE FOR RESIDUE HEM B 147 source : AC3 12) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM B 147 source : AC3 13) chain A residue 37 type sequence M description BINDING SITE FOR RESIDUE CMO A 148 source : AC4 14) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE CMO A 148 source : AC4 15) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE CMO A 148 source : AC4 16) chain A residue 73 type sequence L description BINDING SITE FOR RESIDUE CMO A 148 source : AC4 17) chain A residue 101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links