eF-site ID 2r4x-AB PDB Code 2r4x Chain A, B click to enlarge Title Ligand Migration and Binding in The Dimeric Hemoglobin of Scapharca Inaequivalvis: H69V/I114M co complex Classification OXYGEN BINDING Compound Globin-1 Source Anadara inaequivalvis (Inequivalve ark) (Scapharca inaequivalvis) (GLB1_SCAIN) Sequence A:  SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGVSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKV LASKNFGDKYANAWAKLVAVVQAAL B:  SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLF ADNQETIGYFKRLGDVSQGMANDKLRGVSITLMYALQNFI DQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKV LASKNFGDKYANAWAKLVAVVQAAL Description Functional site 1) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 2) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 3) chain A residue 53 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 4) chain A residue 69 type sequence V description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 5) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 6) chain A residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 7) chain A residue 104 type sequence R description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 8) chain A residue 110 type sequence E description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 9) chain A residue 111 type sequence F description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 10) chain A residue 114 type sequence M description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 11) chain B residue 96 type sequence K description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 12) chain B residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM A 147 source : AC1 13) chain A residue 96 type sequence K description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 14) chain A residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 15) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 16) chain B residue 51 type sequence F description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 17) chain B residue 53 type sequence R description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 18) chain B residue 69 type sequence V description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 19) chain B residue 76 type sequence A description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 20) chain B residue 97 type sequence F description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 21) chain B residue 100 type sequence N description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 22) chain B residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 23) chain B residue 104 type sequence R description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 24) chain B residue 106 type sequence I description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 25) chain B residue 111 type sequence F description BINDING SITE FOR RESIDUE HEM B 147 source : AC2 26) chain A residue 37 type sequence M description BINDING SITE FOR RESIDUE CMO A 148 source : AC3 27) chain A residue 51 type sequence F description BINDING SITE FOR RESIDUE CMO A 148 source : AC3 28) chain A residue 73 type sequence L description BINDING SITE FOR RESIDUE CMO A 148 source : AC3 29) chain B residue 37 type sequence M description BINDING SITE FOR RESIDUE CMO B 148 source : AC4 30) chain B residue 73 type sequence L description BINDING SITE FOR RESIDUE CMO B 148 source : AC4 31) chain A residue 101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1 32) chain B residue 101 type BINDING sequence H description proximal binding residue source Swiss-Prot : SWS_FT_FI1

Display surface Download Links