eF-site ID 2qrz-AB PDB Code 2qrz Chain A, B click to enlarge Title Cdc42 bound to GMP-PCP: Induced Fit by Effector is Required Classification CELL CYCLE Compound Cell division control protein 42 homolog precursor Source Homo sapiens (Human) (CDC42_HUMAN) Sequence A:  MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNY AVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV CFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSAL TQKGLKNVFDEAILAALEPPEPKKSRRCV B:  MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNY AVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLV CFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSAL TQKGLKNVFDEAILAALEPKKSRRCV Description (1)  Cell division control protein 42 homolog precursor Functional site 1) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE MG A 190 source : AC1 2) chain B residue 17 type sequence T description BINDING SITE FOR RESIDUE MG B 190 source : AC2 3) chain A residue 164 type sequence G description BINDING SITE FOR RESIDUE SO4 A 3638 source : AC3 4) chain B residue 164 type sequence G description BINDING SITE FOR RESIDUE SO4 A 3638 source : AC3 5) chain A residue 13 type sequence A description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 6) chain A residue 15 type sequence G description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 7) chain A residue 16 type sequence K description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 8) chain A residue 17 type sequence T description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 9) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 10) chain A residue 60 type sequence G description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 11) chain A residue 61 type sequence Q description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 12) chain A residue 116 type sequence Q description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 13) chain A residue 118 type sequence D description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 14) chain A residue 119 type sequence L description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 15) chain A residue 158 type sequence S description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 16) chain A residue 159 type sequence A description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 17) chain A residue 160 type sequence L description BINDING SITE FOR RESIDUE GCP A 3639 source : AC4 18) chain B residue 11 type sequence D description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 19) chain B residue 12 type sequence G description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 20) chain B residue 13 type sequence A description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 21) chain B residue 15 type sequence G description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 22) chain B residue 16 type sequence K description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 23) chain B residue 17 type sequence T description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 24) chain B residue 18 type sequence C description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 25) chain B residue 28 type sequence F description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 26) chain B residue 60 type sequence G description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 27) chain B residue 61 type sequence Q description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 28) chain B residue 116 type sequence Q description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 29) chain B residue 118 type sequence D description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 30) chain B residue 119 type sequence L description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 31) chain B residue 159 type sequence A description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 32) chain B residue 160 type sequence L description BINDING SITE FOR RESIDUE GCP B 191 source : AC5 33) chain A residue 64 type MOD_RES sequence Y description Phosphotyrosine; by SRC => ECO:0000269|PubMed:14506284 source Swiss-Prot : SWS_FT_FI5 34) chain B residue 64 type MOD_RES sequence Y description Phosphotyrosine; by SRC => ECO:0000269|PubMed:14506284 source Swiss-Prot : SWS_FT_FI5 35) chain A residue 10 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 36) chain A residue 115 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 37) chain B residue 10 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 38) chain B residue 115 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI1 39) chain A residue 57 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 40) chain B residue 57 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538, ECO:0000269|PubMed:20622875 source Swiss-Prot : SWS_FT_FI3 42) chain B residue 32 type MOD_RES sequence Y description (Microbial infection) O-AMP-tyrosine; by Haemophilus IbpA; alternate => ECO:0000269|PubMed:19362538, ECO:0000269|PubMed:20622875 source Swiss-Prot : SWS_FT_FI3 43) chain A residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI9 44) chain B residue 35 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB; alternate => ECO:0000269|PubMed:24905543, ECO:0000269|PubMed:7775453, ECO:0000269|PubMed:7777059 source Swiss-Prot : SWS_FT_FI9 45) chain A residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 46) chain B residue 35 type MOD_RES sequence T description (Microbial infection) O-AMP-threonine; by Vibrio VopS => ECO:0000269|PubMed:19039103 source Swiss-Prot : SWS_FT_FI4 47) chain A residue 188 type MOD_RES sequence C description Cysteine methyl ester => ECO:0000269|PubMed:10676816, ECO:0007744|PDB:1DOA source Swiss-Prot : SWS_FT_FI6 48) chain B residue 188 type MOD_RES sequence C description Cysteine methyl ester => ECO:0000269|PubMed:10676816, ECO:0007744|PDB:1DOA source Swiss-Prot : SWS_FT_FI6 49) chain A residue 188 type LIPID sequence C description S-geranylgeranyl cysteine => ECO:0000269|PubMed:10676816, ECO:0007744|PDB:1DOA source Swiss-Prot : SWS_FT_FI7 50) chain B residue 188 type LIPID sequence C description S-geranylgeranyl cysteine => ECO:0000269|PubMed:10676816, ECO:0007744|PDB:1DOA source Swiss-Prot : SWS_FT_FI7 51) chain A residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI8 52) chain B residue 32 type CARBOHYD sequence Y description (Microbial infection) O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230; alternate => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links