eF-site ID 2qq2-E
PDB Code 2qq2
Chain E

click to enlarge
Title Crystal structure of C-terminal domain of Human acyl-CoA thioesterase 7
Classification HYDROLASE
Compound Cytosolic acyl coenzyme A thioester hydrolase
Source Homo sapiens (Human) (BACH_HUMAN)
Sequence E:  NPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDE
VAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRM
TFTSNKSMEIEVLVDADPVQKRYRAASAFFTYVSLSQEGR
SLPVPQLVPETEDEKKRFEEGKGRYLQMKA
Description (1)  Cytosolic acyl coenzyme A thioester hydrolase (E.C.3.1.2.2)

Display surface

Download
Links