eF-site ID 2qjh-K PDB Code 2qjh Chain K click to enlarge Title M. jannaschii ADH synthase covalently bound to dihydroxyacetone phosphate Classification LYASE Compound Putative aldolase MJ0400 Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (Y400_METJA) Sequence K:  ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPI KGLIDIRKTVNDVAEGGANAVLLHKGIVRHGDVGLIIHLS GGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDED WEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPEL VAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVV AGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVV GITRAVCKIVHENADVEEALKEIR Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-) Functional site 1) chain K residue 31 type ligand sequence P description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 2) chain K residue 33 type ligand sequence D description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 3) chain K residue 34 type ligand sequence H description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 4) chain K residue 184 type ligand sequence K description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 5) chain K residue 208 type ligand sequence A description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 6) chain K residue 209 type ligand sequence G description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 7) chain K residue 210 type ligand sequence G description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 8) chain K residue 236 type ligand sequence V description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 9) chain K residue 237 type ligand sequence G description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 10) chain K residue 238 type ligand sequence R description BINDING SITE FOR RESIDUE 13P K 501 source : BC2 11) chain K residue 33 type ACT_SITE ligand sequence D description Proton acceptor (Probable). source Swiss-Prot : SWS_FT_FI31 12) chain K residue 184 type ACT_SITE ligand sequence K description Schiff-base intermediate with substrate. source Swiss-Prot : SWS_FT_FI32 13) chain K residue 153 type ACT_SITE ligand sequence Y description Proton donor (Probable). source Swiss-Prot : SWS_FT_FI33 14) chain K residue 31 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence P description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 15) chain K residue 33-34 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence DH description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 16) chain K residue 151 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence M description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 17) chain K residue 153 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence Y description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 18) chain K residue 184 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence K description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 19) chain K residue 208-210 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence AGG description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 20) chain K residue 235-239 type binding ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE sequence AVGRN description 1,3-DIHYDROXYACETONEPHOSPHATE binding site source pdb_hetatom : 13P_2qjh_K_501 21) chain K residue 33 type catalytic ligand sequence D description Annotated By Reference To The Literature 1ok4 source CSA : CSA11 22) chain K residue 184 type catalytic ligand sequence K description Annotated By Reference To The Literature 1ok4 source CSA : CSA11 23) chain K residue 153 type catalytic ligand sequence Y description Annotated By Reference To The Literature 1ok4 source CSA : CSA11

Display surface Download Links