eF-site ID 2qjh-K
PDB Code 2qjh
Chain K

click to enlarge
Title M. jannaschii ADH synthase covalently bound to dihydroxyacetone phosphate
Classification LYASE
Compound Putative aldolase MJ0400
Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (Y400_METJA)
Sequence K:  ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPI
KGLIDIRKTVNDVAEGGANAVLLHKGIVRHGDVGLIIHLS
GGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDED
WEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPEL
VAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVV
AGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVV
GITRAVCKIVHENADVEEALKEIR
Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-)


Functional site

1) chain K
residue 31
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

2) chain K
residue 33
type
ligand
sequence D
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

3) chain K
residue 34
type
ligand
sequence H
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

4) chain K
residue 184
type
ligand
sequence K
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

5) chain K
residue 208
type
ligand
sequence A
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

6) chain K
residue 209
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

7) chain K
residue 210
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

8) chain K
residue 236
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

9) chain K
residue 237
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

10) chain K
residue 238
type
ligand
sequence R
description BINDING SITE FOR RESIDUE 13P K 501
source : BC2

11) chain K
residue 33
type ACT_SITE
ligand
sequence D
description Proton acceptor (Probable).
source Swiss-Prot : SWS_FT_FI31

12) chain K
residue 184
type ACT_SITE
ligand
sequence K
description Schiff-base intermediate with substrate.
source Swiss-Prot : SWS_FT_FI32

13) chain K
residue 153
type ACT_SITE
ligand
sequence Y
description Proton donor (Probable).
source Swiss-Prot : SWS_FT_FI33

14) chain K
residue 31
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence P
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

15) chain K
residue 33-34
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence DH
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

16) chain K
residue 151
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence M
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

17) chain K
residue 153
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence Y
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

18) chain K
residue 184
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence K
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

19) chain K
residue 208-210
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence AGG
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

20) chain K
residue 235-239
type binding
ligand 13P: 1,3-DIHYDROXYACETONEPHOSPHATE
sequence AVGRN
description 1,3-DIHYDROXYACETONEPHOSPHATE binding site
source pdb_hetatom : 13P_2qjh_K_501

21) chain K
residue 33
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ok4
source CSA : CSA11

22) chain K
residue 184
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ok4
source CSA : CSA11

23) chain K
residue 153
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1ok4
source CSA : CSA11


Display surface

Download
Links