eF-site ID 2qjg-S PDB Code 2qjg Chain S click to enlarge Title M. jannaschii ADH synthase complexed with F1,6P Classification LYASE Compound Putative aldolase MJ0400 Source null (Y400_METJA) Sequence S:  ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPI KGLIDIRKTVNDVAEGGANAVLLHKGIVRHGVGLIIHLSG GTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDEDW EAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPELV AHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVVVA GGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDVVG ITRAVCKIVHENADVEEALKEIRK Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-) Functional site 1) chain S residue 33 type sequence D description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 2) chain S residue 34 type sequence H description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 3) chain S residue 37 type sequence S description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 4) chain S residue 38 type sequence N description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 5) chain S residue 99 type sequence K description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 6) chain S residue 151 type sequence M description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 7) chain S residue 153 type sequence Y description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 8) chain S residue 155 type sequence R description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 9) chain S residue 184 type sequence K description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 10) chain S residue 209 type sequence G description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 11) chain S residue 210 type sequence G description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 12) chain S residue 235 type sequence A description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 13) chain S residue 236 type sequence V description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 14) chain S residue 237 type sequence G description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 15) chain S residue 238 type sequence R description BINDING SITE FOR RESIDUE F2P S 501 source : CC1 16) chain S residue 33 type ACT_SITE sequence D description Proton acceptor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI1 17) chain S residue 153 type ACT_SITE sequence Y description Proton donor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI2 18) chain S residue 184 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI3 19) chain S residue 33 type BINDING sequence D description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 20) chain S residue 153 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 21) chain S residue 209 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 22) chain S residue 237 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links