eF-site ID 2qjg-Q PDB Code 2qjg Chain Q click to enlarge Title M. jannaschii ADH synthase complexed with F1,6P Classification LYASE Compound Putative aldolase MJ0400 Source null (Y400_METJA) Sequence Q:  MELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGP IKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGHRGYGKDV GLIIHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHV NVGSDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQ NERDPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKG CPAPVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNI FQHDDVVGITRAVCKIVHENADVEEALKEIRK Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-) Functional site 1) chain Q residue 33 type sequence D description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 2) chain Q residue 34 type sequence H description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 3) chain Q residue 37 type sequence S description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 4) chain Q residue 38 type sequence N description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 5) chain Q residue 151 type sequence M description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 6) chain Q residue 153 type sequence Y description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 7) chain Q residue 155 type sequence R description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 8) chain Q residue 184 type sequence K description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 9) chain Q residue 209 type sequence G description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 10) chain Q residue 210 type sequence G description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 11) chain Q residue 235 type sequence A description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 12) chain Q residue 236 type sequence V description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 13) chain Q residue 237 type sequence G description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 14) chain Q residue 238 type sequence R description BINDING SITE FOR RESIDUE F2P Q 501 source : BC8 15) chain Q residue 33 type ACT_SITE sequence D description Proton acceptor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI1 16) chain Q residue 153 type ACT_SITE sequence Y description Proton donor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI2 17) chain Q residue 184 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI3 18) chain Q residue 33 type BINDING sequence D description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 19) chain Q residue 153 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 20) chain Q residue 209 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 21) chain Q residue 237 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links