eF-site ID 2qjg-N PDB Code 2qjg Chain N click to enlarge Title M. jannaschii ADH synthase complexed with F1,6P Classification LYASE Compound Putative aldolase MJ0400 Source null (Y400_METJA) Sequence N:  MELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGP IKGLIDIRKTVNDVAEGGANAVLLHKGIVRHKDVGLIIHL SGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDE DWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPE LVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVV VAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDV VGITRAVCKIVHENADVEEALKEIR Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-) Functional site 1) chain N residue 31 type sequence P description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 2) chain N residue 33 type sequence D description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 3) chain N residue 34 type sequence H description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 4) chain N residue 37 type sequence S description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 5) chain N residue 99 type sequence K description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 6) chain N residue 119 type sequence H description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 7) chain N residue 151 type sequence M description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 8) chain N residue 153 type sequence Y description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 9) chain N residue 155 type sequence R description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 10) chain N residue 184 type sequence K description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 11) chain N residue 209 type sequence G description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 12) chain N residue 210 type sequence G description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 13) chain N residue 236 type sequence V description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 14) chain N residue 237 type sequence G description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 15) chain N residue 238 type sequence R description BINDING SITE FOR RESIDUE F2P N 501 source : AC9 16) chain N residue 33 type ACT_SITE sequence D description Proton acceptor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI1 17) chain N residue 153 type ACT_SITE sequence Y description Proton donor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI2 18) chain N residue 184 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI3 19) chain N residue 33 type BINDING sequence D description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 20) chain N residue 153 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 21) chain N residue 209 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 22) chain N residue 237 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links