eF-site ID 2qjg-L PDB Code 2qjg Chain L click to enlarge Title M. jannaschii ADH synthase complexed with F1,6P Classification LYASE Compound Putative aldolase MJ0400 Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (Y400_METJA) Sequence L:  MELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGP IKGLIDIRKTVNDVAEGGANAVLLHKGIVRHGHRGYVGLI IHLSGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVG SDEDWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNER DPELVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPA PVVVAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQH DDVVGITRAVCKIVHENADVEEALKEIRK Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-) Functional site 1) chain L residue 31 type sequence P description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 2) chain L residue 33 type sequence D description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 3) chain L residue 34 type sequence H description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 4) chain L residue 37 type sequence S description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 5) chain L residue 38 type sequence N description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 6) chain L residue 119 type sequence H description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 7) chain L residue 151 type sequence M description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 8) chain L residue 153 type sequence Y description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 9) chain L residue 155 type sequence R description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 10) chain L residue 184 type sequence K description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 11) chain L residue 208 type sequence A description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 12) chain L residue 209 type sequence G description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 13) chain L residue 210 type sequence G description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 14) chain L residue 235 type sequence A description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 15) chain L residue 236 type sequence V description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 16) chain L residue 237 type sequence G description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 17) chain L residue 238 type sequence R description BINDING SITE FOR RESIDUE F2P L 501 source : AC7 18) chain L residue 33 type BINDING sequence D description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 19) chain L residue 153 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 20) chain L residue 209 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 21) chain L residue 237 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 22) chain L residue 33 type ACT_SITE sequence D description Proton acceptor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI1 23) chain L residue 153 type ACT_SITE sequence Y description Proton donor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI2 24) chain L residue 184 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links