eF-site ID 2qjg-K PDB Code 2qjg Chain K click to enlarge Title M. jannaschii ADH synthase complexed with F1,6P Classification LYASE Compound Putative aldolase MJ0400 Source Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (Y400_METJA) Sequence K:  ELFKDIKNLGKLVRLERIFNRESEKTVIVPMDHGVSNGPI KGLIDIRKTVNDVAEGGANAVLLHKGIVRHGKDVGLIIHL SGGTAISPNPLKKVIVTTVEEAIRMGADAVSIHVNVGSDE DWEAYRDLGMIAETCEYWGMPLIAMMYPRGKHIQNERDPE LVAHAARLGAELGADIVKTSYTGDIDSFRDVVKGCPAPVV VAGGPKTNTDEEFLQMIKDAMEAGAAGVAVGRNIFQHDDV VGITRAVCKIVHENADVEEALKEIRK Description (1)  Putative aldolase MJ0400 (E.C.4.2.1.-) Functional site 1) chain K residue 31 type sequence P description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 2) chain K residue 33 type sequence D description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 3) chain K residue 34 type sequence H description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 4) chain K residue 37 type sequence S description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 5) chain K residue 99 type sequence K description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 6) chain K residue 119 type sequence H description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 7) chain K residue 151 type sequence M description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 8) chain K residue 153 type sequence Y description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 9) chain K residue 155 type sequence R description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 10) chain K residue 184 type sequence K description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 11) chain K residue 209 type sequence G description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 12) chain K residue 210 type sequence G description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 13) chain K residue 235 type sequence A description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 14) chain K residue 236 type sequence V description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 15) chain K residue 237 type sequence G description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 16) chain K residue 238 type sequence R description BINDING SITE FOR RESIDUE F2P K 501 source : AC6 17) chain K residue 33 type BINDING sequence D description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 18) chain K residue 153 type BINDING sequence Y description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 19) chain K residue 209 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 20) chain K residue 237 type BINDING sequence G description BINDING => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI4 21) chain K residue 33 type ACT_SITE sequence D description Proton acceptor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI1 22) chain K residue 153 type ACT_SITE sequence Y description Proton donor => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI2 23) chain K residue 184 type ACT_SITE sequence K description Schiff-base intermediate with substrate => ECO:0000305|PubMed:17713928 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links