eF-site ID 2qiu-D
PDB Code 2qiu
Chain D

click to enlarge
Title Structure of Human Arg-Insulin
Classification HORMONE
Compound Insulin
Source ORGANISM_COMMON: human; ORGANISM_SCIENTIFIC: Homo sapiens;
Sequence D:  FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Description (1)  Insulin


Functional site

1) chain D
residue 10
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN D 102
source : AC2


Display surface

Download
Links