eF-site ID 2qic-A
PDB Code 2qic
Chain A

click to enlarge
Title Crystal Structure of the ING1 PHD Finger in complex with a Histone H3K4ME3 peptide
Classification ANTITUMOR PROTEIN, APOPTOSIS
Compound Inhibitor of growth protein 1
Source Homo sapiens (Human) (2QIC)
Sequence A:  EPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPK
GKWYCPKCRGE
Description (1)  Inhibitor of growth protein 1, H3K4ME3 PEPTIDE


Functional site

1) chain A
residue 213
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 300
source : AC1

2) chain A
residue 215
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 300
source : AC1

3) chain A
residue 237
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 300
source : AC1

4) chain A
residue 240
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 300
source : AC1

5) chain A
residue 226
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 400
source : AC2

6) chain A
residue 231
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 400
source : AC2

7) chain A
residue 253
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 400
source : AC2

8) chain A
residue 256
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 400
source : AC2


Display surface

Download
Links