eF-site ID 2qfo-A PDB Code 2qfo Chain A click to enlarge Title HSP90 complexed with A143571 and A516383 Classification CHAPERONE Compound Heat shock protein HSP 90-alpha Source Homo sapiens (Human) (HS90A_HUMAN) Sequence A:  VETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDAL DKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGI GMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGV GFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDT GEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGY PITLFVE Description Functional site 1) chain A residue 51 type sequence N description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 2) chain A residue 55 type sequence A description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 3) chain A residue 93 type sequence D description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 4) chain A residue 96 type sequence I description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 5) chain A residue 97 type sequence G description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 6) chain A residue 98 type sequence M description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 7) chain A residue 107 type sequence L description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 8) chain A residue 184 type sequence T description BINDING SITE FOR RESIDUE A13 A 900 source : AC1 9) chain A residue 51 type sequence N description BINDING SITE FOR RESIDUE A51 A 999 source : AC2 10) chain A residue 106 type sequence N description BINDING SITE FOR RESIDUE A51 A 999 source : AC2 11) chain A residue 135 type sequence G description BINDING SITE FOR RESIDUE A51 A 999 source : AC2 12) chain A residue 137 type sequence G description BINDING SITE FOR RESIDUE A51 A 999 source : AC2 13) chain A residue 138 type sequence F description BINDING SITE FOR RESIDUE A51 A 999 source : AC2 14) chain A residue 38-47 type prosite sequence YSNKEIFLRE description HSP90 Heat shock hsp90 proteins family signature. YsNKEIFLRE source prosite : PS00298 15) chain A residue 51 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 93 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 138 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI1 18) chain A residue 112 type BINDING sequence K description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 58 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P07901 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 84 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:P07901 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links