eF-site ID 2qe7-G
PDB Code 2qe7
Chain G

click to enlarge
Title Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
Classification HYDROLASE
Compound ATP synthase subunit alpha
Source Bacillus sp. TA2.A1 (Q71CG2_9BACI)
Sequence G:  GMREIKRRIRSVKNTRQITKAMKMVAAAKLRRAQETAENA
RPYADKISHPMLEARPVKKTGYMVITSDRGLAGPYNANIL
RLVSKTIEERHQSKDEYVIFAVGRKGRDFFKKRGYPVVEE
VTGISDTPSLTEIQDIAQSAIGMFADETFDKLTIFYNEFV
SPIVQRPVEKQLLPLTSLLPKYAETLIYSALLDAKASEFG
ARMTAMGNATDNATEMLETLTLQFNRA
Description (1)  ATP synthase subunit alpha (E.C.3.6.1.34), ATP synthase subunit beta (E.C.3.6.1.34), ATP synthase subunit gamma (E.C.3.6.1.34), ATP synthase subunit epsilon (E.C.3.6.1.34)

Display surface

Download
Links