eF-site ID 2qe7-F
PDB Code 2qe7
Chain F

click to enlarge
Title Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
Classification HYDROLASE
Compound ATP synthase subunit alpha
Source Bacillus sp. TA2.A1 (Q71CG2_9BACI)
Sequence F:  NKGRIIQVMGPVVDIQFESGQLPDIYNAITIERPQGGTLT
VEAAVHLGDNVVRCVAMASTDGLVRGLEAVDTGAPISVPV
GKATLGRVFNVLGEPIDEQGEVNAEERHPIHRPAPEFEEL
STADEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVLI
QELINNVAQEHGGLSVFAGVGERTREGNDLYHEMKDSGVI
SKTSMVFGQMNEPPGARLRVALTGLTMAEYFRDREGQDVL
LFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQL
QERITSTKKGSITSIQAIYVPADDYTDPAPATTFAHLDAT
TNLERKLAEMGIYPAVDPLASTSRILSPAVVGEEHYRVAR
GVQQVLQRYNDLQDIIAILGMDELSDEDKLIVARARKIQR
FLSQPFHVAEQFTGMPGKYVPVKETVRGFKEILEGKHDNL
PEEAFYMVGTIDEAVEKAKKL
Description (1)  ATP synthase subunit alpha (E.C.3.6.1.34), ATP synthase subunit beta (E.C.3.6.1.34), ATP synthase subunit gamma (E.C.3.6.1.34), ATP synthase subunit epsilon (E.C.3.6.1.34)


Functional site

1) chain F
residue 151-158
type NP_BIND
ligand
sequence GGAGVGKT
description ATP (By similarity).
source Swiss-Prot : SWS_FT_FI9

2) chain F
residue 345
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1ohh
source CSA : CSA3

3) chain F
residue 183
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1ohh
source CSA : CSA6

4) chain F
residue 184
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1ohh
source CSA : CSA6

5) chain F
residue 157
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ohh
source CSA : CSA6


Display surface

Download
Links