eF-site ID 2qe7-C
PDB Code 2qe7
Chain C

click to enlarge
Title Crystal structure of the f1-atpase from the thermoalkaliphilic bacterium bacillus sp. ta2.a1
Classification HYDROLASE
Compound ATP synthase subunit alpha
Source Bacillus sp. TA2.A1 (Q71CG2_9BACI)
Sequence C:  EVGTVIQVGDGIARVHGLEKVMAGELLEFENGVMGMAQNL
EEDNVGVVILGPYTEIREGTQVKRTGRIMEVPVGEALLGR
VVNPLGQPLDGRGPIETAEYRPIESPAPGVMDRKSVHEPL
QTGIKAIDSMIPIGRGQRELIIGDRQTGKTTIAIDTIINQ
KGQDVICIYVAIGQKQSTVAGVVETLRQHDALDYTIVVTA
SASEPAPLLYLAPYAGCAMGEYFMYKGKHALVVYDDLSKQ
AAAYRELSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSD
EKGGGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLES
DLFYSGVRPAVNVGISVSRVGGAAQIKAMKKVAGTLRLDL
AQYRELQAFAQFGSDLDKATQAKLNRGERTVEILKQDEHK
PMPVEEQVISIYAVTNGFMDDIPVEDVRRFEEELLSFMRA
NKDSLLDHIRQTGELPDTKELDAAIEEFKKGFTP
Description (1)  ATP synthase subunit alpha (E.C.3.6.1.34), ATP synthase subunit beta (E.C.3.6.1.34), ATP synthase subunit gamma (E.C.3.6.1.34), ATP synthase subunit epsilon (E.C.3.6.1.34)


Functional site

1) chain C
residue 362
type SITE
ligand
sequence S
description Required for activity (By similarity).
source Swiss-Prot : SWS_FT_FI5

2) chain C
residue 169-176
type NP_BIND
ligand
sequence GDRQTGKT
description ATP (By similarity).
source Swiss-Prot : SWS_FT_FI6

3) chain C
residue 365
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1ohh
source CSA : CSA4

4) chain C
residue 175
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ohh
source CSA : CSA9

5) chain C
residue 201
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ohh
source CSA : CSA9

6) chain C
residue 200
type catalytic
ligand
sequence Q
description Annotated By Reference To The Literature 1ohh
source CSA : CSA9


Display surface

Download
Links