eF-site ID 2qc8-I
PDB Code 2qc8
Chain I

click to enlarge
Title Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate
Classification LIGASE
Compound Glutamine synthetase
Source Homo sapiens (Human) (GLNA_HUMAN)
Sequence I:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Description (1)  Glutamine synthetase (E.C.6.3.1.2)


Functional site

1) chain I
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 401
source : CC7

2) chain I
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 401
source : CC7

3) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 401
source : CC7

4) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

5) chain I
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

6) chain I
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

7) chain I
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

8) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 403
source : CC9

9) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 403
source : CC9

10) chain I
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL I 709
source : EC3

11) chain I
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL J 710
source : EC4

12) chain I
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

13) chain I
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

14) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

15) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

16) chain I
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

17) chain I
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

18) chain I
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

19) chain I
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

20) chain I
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

21) chain I
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

22) chain I
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

23) chain I
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

24) chain I
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

25) chain I
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

26) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

27) chain I
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

28) chain I
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

29) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

30) chain I
residue 248
type
ligand
sequence N
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

31) chain I
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

32) chain I
residue 251
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

33) chain I
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

34) chain I
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

35) chain I
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

36) chain I
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

37) chain I
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

38) chain I
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

39) chain I
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

40) chain I
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

41) chain I
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

42) chain I
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

43) chain I
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

44) chain I
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

45) chain I
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

46) chain I
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

47) chain I
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

48) chain I
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

49) chain I
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

50) chain I
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

51) chain I
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

52) chain I
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

53) chain I
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

54) chain I
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

55) chain I
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

56) chain I
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

57) chain I
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

58) chain I
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

59) chain I
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

60) chain I
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

61) chain I
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

62) chain I
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

63) chain I
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

64) chain I
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

65) chain I
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

66) chain I
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

67) chain I
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

68) chain I
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

69) chain I
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

70) chain I
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

71) chain I
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

72) chain I
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

73) chain I
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

74) chain I
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA9

75) chain I
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA9

76) chain I
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA9


Display surface

Download
Links