eF-site ID 2qc8-C
PDB Code 2qc8
Chain C

click to enlarge
Title Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate
Classification LIGASE
Compound Glutamine synthetase
Source Homo sapiens (Human) (GLNA_HUMAN)
Sequence C:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Description (1)  Glutamine synthetase (E.C.6.3.1.2)


Functional site

1) chain C
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 401
source : AC7

2) chain C
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 401
source : AC7

3) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 401
source : AC7

4) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

5) chain C
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

6) chain C
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

7) chain C
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

8) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 403
source : AC9

9) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 403
source : AC9

10) chain C
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL B 701
source : DC4

11) chain C
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL C 702
source : DC5

12) chain C
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL C 702
source : DC5

13) chain C
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

14) chain C
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

15) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

16) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

17) chain C
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

18) chain C
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

19) chain C
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

20) chain C
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

21) chain C
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

22) chain C
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

23) chain C
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

24) chain C
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

25) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

26) chain C
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

27) chain C
residue 162
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

28) chain C
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

29) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

30) chain C
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

31) chain C
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

32) chain C
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

33) chain C
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

34) chain C
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

35) chain C
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

36) chain C
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

37) chain C
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

38) chain C
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

39) chain C
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

40) chain C
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

41) chain C
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

42) chain C
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

43) chain C
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

44) chain C
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

45) chain C
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

46) chain C
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

47) chain C
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

48) chain C
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

49) chain C
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

50) chain C
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

51) chain C
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

52) chain C
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

53) chain C
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

54) chain C
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

55) chain C
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

56) chain C
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

57) chain C
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

58) chain C
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

59) chain C
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

60) chain C
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

61) chain C
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

62) chain C
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

63) chain C
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

64) chain C
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

65) chain C
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

66) chain C
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

67) chain C
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

68) chain C
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

69) chain C
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

70) chain C
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

71) chain C
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

72) chain C
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

73) chain C
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA3

74) chain C
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA3

75) chain C
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA3


Display surface

Download
Links