eF-site ID 2qc8-ABCDEFGHIJ
PDB Code 2qc8
Chain A, B, C, D, E, F, G, H, I, J
Title Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate
Classification LIGASE
Compound Glutamine synthetase
Source Homo sapiens (Human) (GLNA_HUMAN)
Sequence A:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
B:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
C:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
D:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
E:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNET
F:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
G:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
H:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
I:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
J:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS
EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF
RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP
WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR
AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC
EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG
AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD
PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV
GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Description (1)  Glutamine synthetase (E.C.6.3.1.2)


Functional site

1) chain A
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 401
source : AC1

2) chain A
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 401
source : AC1

3) chain A
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 401
source : AC1

4) chain A
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 402
source : AC2

5) chain A
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN A 402
source : AC2

6) chain A
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 402
source : AC2

7) chain A
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN A 402
source : AC2

8) chain A
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 403
source : AC3

9) chain A
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN A 403
source : AC3

10) chain B
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 401
source : AC4

11) chain B
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 401
source : AC4

12) chain B
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 401
source : AC4

13) chain B
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 402
source : AC5

14) chain B
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN B 402
source : AC5

15) chain B
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 402
source : AC5

16) chain B
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN B 402
source : AC5

17) chain B
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 403
source : AC6

18) chain B
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN B 403
source : AC6

19) chain C
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 401
source : AC7

20) chain C
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 401
source : AC7

21) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 401
source : AC7

22) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

23) chain C
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

24) chain C
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

25) chain C
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN C 402
source : AC8

26) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 403
source : AC9

27) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN C 403
source : AC9

28) chain D
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 401
source : BC1

29) chain D
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 401
source : BC1

30) chain D
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 401
source : BC1

31) chain D
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 402
source : BC2

32) chain D
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN D 402
source : BC2

33) chain D
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 402
source : BC2

34) chain D
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 403
source : BC3

35) chain D
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN D 403
source : BC3

36) chain E
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 401
source : BC4

37) chain E
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 401
source : BC4

38) chain E
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 401
source : BC4

39) chain E
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 402
source : BC5

40) chain E
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN E 402
source : BC5

41) chain E
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 402
source : BC5

42) chain E
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN E 402
source : BC5

43) chain E
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 403
source : BC6

44) chain E
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN E 403
source : BC6

45) chain F
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 401
source : BC7

46) chain F
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 401
source : BC7

47) chain F
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 401
source : BC7

48) chain F
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 402
source : BC8

49) chain F
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN F 402
source : BC8

50) chain F
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 402
source : BC8

51) chain F
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN F 402
source : BC8

52) chain F
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 403
source : BC9

53) chain F
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN F 403
source : BC9

54) chain G
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 401
source : CC1

55) chain G
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 401
source : CC1

56) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 401
source : CC1

57) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 402
source : CC2

58) chain G
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN G 402
source : CC2

59) chain G
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 402
source : CC2

60) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 403
source : CC3

61) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN G 403
source : CC3

62) chain H
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 401
source : CC4

63) chain H
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 401
source : CC4

64) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 401
source : CC4

65) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 402
source : CC5

66) chain H
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN H 402
source : CC5

67) chain H
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 402
source : CC5

68) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 403
source : CC6

69) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN H 403
source : CC6

70) chain I
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 401
source : CC7

71) chain I
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 401
source : CC7

72) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 401
source : CC7

73) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

74) chain I
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

75) chain I
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

76) chain I
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE MN I 402
source : CC8

77) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 403
source : CC9

78) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN I 403
source : CC9

79) chain J
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 401
source : DC1

80) chain J
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 401
source : DC1

81) chain J
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 401
source : DC1

82) chain J
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 402
source : DC2

83) chain J
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE MN J 402
source : DC2

84) chain J
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 402
source : DC2

85) chain J
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 403
source : DC3

86) chain J
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE MN J 403
source : DC3

87) chain B
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL B 701
source : DC4

88) chain B
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL B 701
source : DC4

89) chain C
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL B 701
source : DC4

90) chain C
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL C 702
source : DC5

91) chain C
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL C 702
source : DC5

92) chain D
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL C 702
source : DC5

93) chain A
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL A 703
source : DC6

94) chain E
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL A 703
source : DC6

95) chain E
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL A 703
source : DC6

96) chain D
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL D 704
source : DC7

97) chain E
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL D 704
source : DC7

98) chain A
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL B 705
source : DC8

99) chain A
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL B 705
source : DC8

100) chain B
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL B 705
source : DC8

101) chain F
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL F 706
source : DC9

102) chain J
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL F 706
source : DC9

103) chain F
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 707
source : EC1

104) chain G
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 707
source : EC1

105) chain G
residue 29
type
ligand
sequence M
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

106) chain G
residue 43
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

107) chain G
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

108) chain H
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL G 708
source : EC2

109) chain H
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL I 709
source : EC3

110) chain I
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL I 709
source : EC3

111) chain I
residue 44
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL J 710
source : EC4

112) chain J
residue 193
type
ligand
sequence T
description BINDING SITE FOR RESIDUE CL J 710
source : EC4

113) chain A
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

114) chain A
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

115) chain A
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

116) chain A
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

117) chain A
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

118) chain A
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

119) chain A
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

120) chain A
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

121) chain A
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

122) chain A
residue 262
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

123) chain A
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

124) chain A
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

125) chain A
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

126) chain A
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP A 501
source : EC5

127) chain A
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

128) chain A
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

129) chain A
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

130) chain A
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

131) chain A
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

132) chain A
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

133) chain A
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

134) chain A
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

135) chain A
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

136) chain A
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

137) chain A
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

138) chain A
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

139) chain E
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S A 601
source : EC6

140) chain B
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

141) chain B
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

142) chain B
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

143) chain B
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

144) chain B
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

145) chain B
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

146) chain B
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

147) chain B
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

148) chain B
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

149) chain B
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

150) chain B
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

151) chain B
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

152) chain B
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

153) chain B
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP B 501
source : EC7

154) chain A
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

155) chain B
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

156) chain B
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

157) chain B
residue 162
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

158) chain B
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

159) chain B
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

160) chain B
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

161) chain B
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

162) chain B
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

163) chain B
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

164) chain B
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

165) chain B
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

166) chain B
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

167) chain B
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S B 601
source : EC8

168) chain C
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

169) chain C
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

170) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

171) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

172) chain C
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

173) chain C
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

174) chain C
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

175) chain C
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

176) chain C
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

177) chain C
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

178) chain C
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

179) chain C
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP C 501
source : EC9

180) chain B
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

181) chain C
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

182) chain C
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

183) chain C
residue 162
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

184) chain C
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

185) chain C
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

186) chain C
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

187) chain C
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

188) chain C
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

189) chain C
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

190) chain C
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

191) chain C
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

192) chain C
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

193) chain C
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S C 601
source : FC1

194) chain D
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

195) chain D
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

196) chain D
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

197) chain D
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

198) chain D
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

199) chain D
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

200) chain D
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

201) chain D
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

202) chain D
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

203) chain D
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

204) chain D
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

205) chain D
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

206) chain D
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP D 501
source : FC2

207) chain C
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

208) chain D
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

209) chain D
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

210) chain D
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

211) chain D
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

212) chain D
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

213) chain D
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

214) chain D
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

215) chain D
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

216) chain D
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

217) chain D
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

218) chain D
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

219) chain D
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S D 601
source : FC3

220) chain E
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

221) chain E
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

222) chain E
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

223) chain E
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

224) chain E
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

225) chain E
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

226) chain E
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

227) chain E
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

228) chain E
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

229) chain E
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

230) chain E
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

231) chain E
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

232) chain E
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP E 501
source : FC4

233) chain D
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

234) chain E
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

235) chain E
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

236) chain E
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

237) chain E
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

238) chain E
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

239) chain E
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

240) chain E
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

241) chain E
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

242) chain E
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

243) chain E
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

244) chain E
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

245) chain E
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S E 601
source : FC5

246) chain F
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

247) chain F
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

248) chain F
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

249) chain F
residue 191
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

250) chain F
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

251) chain F
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

252) chain F
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

253) chain F
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

254) chain F
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

255) chain F
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

256) chain F
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

257) chain F
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

258) chain F
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

259) chain F
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

260) chain F
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP F 501
source : FC6

261) chain F
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

262) chain F
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

263) chain F
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

264) chain F
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

265) chain F
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

266) chain F
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

267) chain F
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

268) chain F
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

269) chain F
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

270) chain F
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

271) chain F
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

272) chain J
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S F 601
source : FC7

273) chain G
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

274) chain G
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

275) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

276) chain G
residue 191
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

277) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

278) chain G
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

279) chain G
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

280) chain G
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

281) chain G
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

282) chain G
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

283) chain G
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

284) chain G
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

285) chain G
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

286) chain G
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

287) chain G
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP G 501
source : FC8

288) chain F
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

289) chain G
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

290) chain G
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

291) chain G
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

292) chain G
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

293) chain G
residue 248
type
ligand
sequence N
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

294) chain G
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

295) chain G
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

296) chain G
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

297) chain G
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

298) chain G
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

299) chain G
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

300) chain G
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

301) chain G
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S G 601
source : FC9

302) chain H
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

303) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

304) chain H
residue 191
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

305) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

306) chain H
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

307) chain H
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

308) chain H
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

309) chain H
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

310) chain H
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

311) chain H
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

312) chain H
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

313) chain H
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

314) chain H
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP H 501
source : GC1

315) chain G
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

316) chain H
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

317) chain H
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

318) chain H
residue 162
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

319) chain H
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

320) chain H
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

321) chain H
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

322) chain H
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

323) chain H
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

324) chain H
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

325) chain H
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

326) chain H
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

327) chain H
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S H 601
source : GC2

328) chain I
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

329) chain I
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

330) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

331) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

332) chain I
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

333) chain I
residue 206
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

334) chain I
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

335) chain I
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

336) chain I
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

337) chain I
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

338) chain I
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

339) chain I
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

340) chain I
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

341) chain I
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP I 501
source : GC3

342) chain H
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

343) chain I
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

344) chain I
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

345) chain I
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

346) chain I
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

347) chain I
residue 248
type
ligand
sequence N
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

348) chain I
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

349) chain I
residue 251
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

350) chain I
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

351) chain I
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

352) chain I
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

353) chain I
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

354) chain I
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

355) chain I
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

356) chain I
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S I 601
source : GC4

357) chain J
residue 130
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

358) chain J
residue 132
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

359) chain J
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

360) chain J
residue 191
type
ligand
sequence A
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

361) chain J
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

362) chain J
residue 205
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

363) chain J
residue 207
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

364) chain J
residue 208
type
ligand
sequence P
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

365) chain J
residue 255
type
ligand
sequence N
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

366) chain J
residue 257
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

367) chain J
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

368) chain J
residue 324
type
ligand
sequence R
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

369) chain J
residue 336
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

370) chain J
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE ADP J 501
source : GC5

371) chain I
residue 63
type
ligand
sequence D
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

372) chain J
residue 134
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

373) chain J
residue 136
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

374) chain J
residue 162
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

375) chain J
residue 196
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

376) chain J
residue 203
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

377) chain J
residue 249
type
ligand
sequence G
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

378) chain J
residue 253
type
ligand
sequence H
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

379) chain J
residue 299
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

380) chain J
residue 305
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

381) chain J
residue 306
type
ligand
sequence T
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

382) chain J
residue 319
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

383) chain J
residue 338
type
ligand
sequence E
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

384) chain J
residue 340
type
ligand
sequence R
description BINDING SITE FOR RESIDUE P3S J 601
source : GC6

385) chain A
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

386) chain B
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

387) chain C
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

388) chain D
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

389) chain E
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

390) chain F
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

391) chain G
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

392) chain H
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

393) chain I
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

394) chain J
residue 62-79
type prosite
ligand
sequence FDGSSTLQSEGSNSDMYL
description Glutamine synthetase signature 1. [FYWL]-D-G-S-S-x(6,8)-[DENQSTAK]-[SA]-[DE]-x(2)-[LIVMFY]
source prosite : PS00180

395) chain A
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

396) chain B
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

397) chain C
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

398) chain D
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

399) chain E
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

400) chain F
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

401) chain G
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

402) chain H
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

403) chain I
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

404) chain J
residue 241-257
type prosite
ligand
sequence KPIPGNWNGAGCHTNFS
description Glutamine synthetase putative ATP-binding region signature. K-P-[LIVMFYA]-x(3,5)-[NPAT]-[GA]-[GSTAN]-[GA]-x-H-x(3)-S
source prosite : PS00181

405) chain A
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

406) chain A
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

407) chain B
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

408) chain B
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

409) chain B
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

410) chain B
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

411) chain B
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

412) chain B
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

413) chain B
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

414) chain B
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

415) chain B
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

416) chain B
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

417) chain B
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

418) chain B
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

419) chain B
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_B_501

420) chain A
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

421) chain A
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

422) chain B
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

423) chain B
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

424) chain B
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

425) chain B
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

426) chain B
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

427) chain B
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

428) chain B
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

429) chain B
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

430) chain B
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

431) chain B
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

432) chain B
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

433) chain B
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

434) chain B
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

435) chain B
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

436) chain B
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_B_601

437) chain A
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

438) chain A
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

439) chain A
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

440) chain A
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

441) chain A
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

442) chain A
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

443) chain A
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

444) chain A
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

445) chain A
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

446) chain A
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

447) chain A
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

448) chain A
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

449) chain A
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

450) chain E
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

451) chain E
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_A_501

452) chain A
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

453) chain A
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

454) chain A
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

455) chain A
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

456) chain A
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

457) chain A
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

458) chain A
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

459) chain A
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

460) chain A
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

461) chain A
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

462) chain A
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

463) chain A
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

464) chain A
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

465) chain A
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

466) chain A
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

467) chain E
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

468) chain E
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_A_601

469) chain B
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

470) chain B
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

471) chain C
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

472) chain C
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

473) chain C
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

474) chain C
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

475) chain C
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

476) chain C
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

477) chain C
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

478) chain C
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

479) chain C
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

480) chain C
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

481) chain C
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

482) chain C
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

483) chain C
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_C_501

484) chain B
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

485) chain B
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

486) chain C
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

487) chain C
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

488) chain C
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

489) chain C
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

490) chain C
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

491) chain C
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

492) chain C
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

493) chain C
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

494) chain C
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

495) chain C
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

496) chain C
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

497) chain C
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

498) chain C
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

499) chain C
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

500) chain C
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_C_601

501) chain C
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

502) chain C
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

503) chain D
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

504) chain D
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

505) chain D
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

506) chain D
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

507) chain D
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

508) chain D
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

509) chain D
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

510) chain D
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

511) chain D
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

512) chain D
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

513) chain D
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

514) chain D
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

515) chain D
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_D_501

516) chain C
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

517) chain C
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

518) chain D
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

519) chain D
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

520) chain D
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

521) chain D
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

522) chain D
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

523) chain D
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

524) chain D
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

525) chain D
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

526) chain D
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

527) chain D
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

528) chain D
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

529) chain D
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

530) chain D
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

531) chain D
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

532) chain D
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_D_601

533) chain D
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

534) chain D
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

535) chain E
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

536) chain E
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

537) chain E
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

538) chain E
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

539) chain E
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

540) chain E
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

541) chain E
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

542) chain E
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

543) chain E
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

544) chain E
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

545) chain E
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

546) chain E
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_E_501

547) chain D
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

548) chain D
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

549) chain E
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

550) chain E
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

551) chain E
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

552) chain E
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

553) chain E
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

554) chain E
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

555) chain E
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

556) chain E
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

557) chain E
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

558) chain E
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

559) chain E
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

560) chain E
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

561) chain E
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

562) chain E
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

563) chain E
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_E_601

564) chain F
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

565) chain F
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

566) chain G
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

567) chain G
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

568) chain G
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

569) chain G
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

570) chain G
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

571) chain G
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

572) chain G
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

573) chain G
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

574) chain G
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

575) chain G
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

576) chain G
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_G_501

577) chain F
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

578) chain F
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

579) chain G
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

580) chain G
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

581) chain G
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

582) chain G
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

583) chain G
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

584) chain G
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

585) chain G
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

586) chain G
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

587) chain G
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

588) chain G
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

589) chain G
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

590) chain G
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

591) chain G
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

592) chain G
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

593) chain G
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_G_601

594) chain F
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

595) chain F
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

596) chain F
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

597) chain F
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

598) chain F
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

599) chain F
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

600) chain F
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

601) chain F
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

602) chain F
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

603) chain F
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

604) chain F
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

605) chain F
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

606) chain F
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

607) chain J
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

608) chain J
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_F_501

609) chain F
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

610) chain F
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

611) chain F
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

612) chain F
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

613) chain F
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

614) chain F
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

615) chain F
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

616) chain F
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

617) chain F
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

618) chain F
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

619) chain F
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

620) chain F
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

621) chain F
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

622) chain F
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

623) chain J
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

624) chain J
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_F_601

625) chain G
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

626) chain G
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

627) chain H
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

628) chain H
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

629) chain H
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

630) chain H
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

631) chain H
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

632) chain H
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

633) chain H
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

634) chain H
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

635) chain H
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

636) chain H
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

637) chain H
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

638) chain H
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

639) chain H
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_H_501

640) chain G
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

641) chain G
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

642) chain H
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

643) chain H
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

644) chain H
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

645) chain H
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

646) chain H
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

647) chain H
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

648) chain H
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

649) chain H
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

650) chain H
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

651) chain H
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

652) chain H
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

653) chain H
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

654) chain H
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

655) chain H
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

656) chain H
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_H_601

657) chain H
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

658) chain H
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

659) chain I
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

660) chain I
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

661) chain I
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

662) chain I
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

663) chain I
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

664) chain I
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

665) chain I
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

666) chain I
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

667) chain I
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

668) chain I
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

669) chain I
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

670) chain I
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

671) chain I
residue 340
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_I_501

672) chain H
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

673) chain H
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

674) chain I
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

675) chain I
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

676) chain I
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

677) chain I
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

678) chain I
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

679) chain I
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

680) chain I
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

681) chain I
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

682) chain I
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

683) chain I
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

684) chain I
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

685) chain I
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

686) chain I
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

687) chain I
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_I_601

688) chain I
residue 43
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence K
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

689) chain I
residue 60-61
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WN
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

690) chain J
residue 130-134
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence WFGME
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

691) chain J
residue 191
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence A
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

692) chain J
residue 194
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence N
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

693) chain J
residue 203
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

694) chain J
residue 205-208
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence QIGP
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

695) chain J
residue 253
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence H
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

696) chain J
residue 255-257
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence NFS
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

697) chain J
residue 262
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

698) chain J
residue 319
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

699) chain J
residue 324
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence R
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

700) chain J
residue 335-336
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence GY
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

701) chain J
residue 338
type binding
ligand ADP: ADENOSINE-5'-DIPHOSPHATE
sequence E
description ADENOSINE-5'-DIPHOSPHATE binding site
source pdb_hetatom : ADP_2qc8_J_501

702) chain I
residue 63
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence D
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

703) chain I
residue 66
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence S
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

704) chain J
residue 134
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

705) chain J
residue 136
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

706) chain J
residue 162
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Y
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

707) chain J
residue 194
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence N
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

708) chain J
residue 196-197
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence EV
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

709) chain J
residue 201
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence Q
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

710) chain J
residue 203
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

711) chain J
residue 248-251
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence NGAG
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

712) chain J
residue 253
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence H
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

713) chain J
residue 299
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

714) chain J
residue 304-306
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence HET
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

715) chain J
residue 319
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

716) chain J
residue 324
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

717) chain J
residue 338
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence E
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

718) chain J
residue 340
type binding
ligand P3S: L-METHIONINE-S-SULFOXIMINE PHOSPHATE
sequence R
description L-METHIONINE-S-SULFOXIMINE PHOSPHATE binding site
source pdb_hetatom : P3S_2qc8_J_601

719) chain A
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA1

720) chain A
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA1

721) chain A
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA1

722) chain B
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA2

723) chain B
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA2

724) chain B
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA2

725) chain C
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA3

726) chain C
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA3

727) chain C
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA3

728) chain D
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA4

729) chain D
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA4

730) chain D
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA4

731) chain E
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA5

732) chain E
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA5

733) chain E
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA5

734) chain F
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA6

735) chain F
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA6

736) chain F
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA6

737) chain G
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA7

738) chain G
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA7

739) chain G
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA7

740) chain H
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA8

741) chain H
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA8

742) chain H
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA8

743) chain I
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA9

744) chain I
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA9

745) chain I
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA9

746) chain J
residue 319
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1hto
source CSA : CSA10

747) chain J
residue 305
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1hto
source CSA : CSA10

748) chain J
residue 63
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1hto
source CSA : CSA10


Display surface

Download
Links