eF-site ID 2qc8-A PDB Code 2qc8 Chain A click to enlarge Title Crystal structure of human glutamine synthetase in complex with ADP and methionine sulfoximine phosphate Classification LIGASE Compound Glutamine synthetase Source Homo sapiens (Human) (GLNA_HUMAN) Sequence A:  NKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDS EPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPF RKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHP WFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADR AYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPC EGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNG AGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYD PKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTV GQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG Description Functional site 1) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE MN A 401 source : AC1 2) chain A residue 196 type sequence E description BINDING SITE FOR RESIDUE MN A 401 source : AC1 3) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE MN A 401 source : AC1 4) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE MN A 402 source : AC2 5) chain A residue 253 type sequence H description BINDING SITE FOR RESIDUE MN A 402 source : AC2 6) chain A residue 338 type sequence E description BINDING SITE FOR RESIDUE MN A 402 source : AC2 7) chain A residue 340 type sequence R description BINDING SITE FOR RESIDUE MN A 402 source : AC2 8) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE MN A 403 source : AC3 9) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE MN A 403 source : AC3 10) chain A residue 193 type sequence T description BINDING SITE FOR RESIDUE CL A 703 source : DC6 11) chain A residue 29 type sequence M description BINDING SITE FOR RESIDUE CL B 705 source : DC8 12) chain A residue 44 type sequence T description BINDING SITE FOR RESIDUE CL B 705 source : DC8 13) chain A residue 130 type sequence W description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 14) chain A residue 132 type sequence G description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 15) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 16) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 17) chain A residue 205 type sequence Q description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 18) chain A residue 207 type sequence G description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 19) chain A residue 208 type sequence P description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 20) chain A residue 255 type sequence N description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 21) chain A residue 257 type sequence S description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 22) chain A residue 262 type sequence R description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 23) chain A residue 319 type sequence R description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 24) chain A residue 324 type sequence R description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 25) chain A residue 336 type sequence Y description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 26) chain A residue 338 type sequence E description BINDING SITE FOR RESIDUE ADP A 501 source : EC5 27) chain A residue 134 type sequence E description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 28) chain A residue 136 type sequence E description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 29) chain A residue 196 type sequence E description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 30) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 31) chain A residue 249 type sequence G description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 32) chain A residue 253 type sequence H description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 33) chain A residue 299 type sequence R description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 34) chain A residue 305 type sequence E description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 35) chain A residue 306 type sequence T description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 36) chain A residue 319 type sequence R description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 37) chain A residue 338 type sequence E description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 38) chain A residue 340 type sequence R description BINDING SITE FOR RESIDUE P3S A 601 source : EC6 39) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE P3S B 601 source : EC8 40) chain A residue 104 type MOD_RES sequence Y description Phosphotyrosine => ECO:0000250|UniProtKB:P15105 source Swiss-Prot : SWS_FT_FI4 41) chain A residue 343 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI5 42) chain A residue 62-79 type prosite sequence FDGSSTLQSEGSNSDMYL description GLNA_1 Glutamine synthetase signature 1. FDGSStlqsegs.NSDmyL source prosite : PS00180 43) chain A residue 241-257 type prosite sequence KPIPGNWNGAGCHTNFS description GLNA_ATP Glutamine synthetase putative ATP-binding region signature. KPIpgnw.NGAGcHtnfS source prosite : PS00181 44) chain A residue 134 type BINDING sequence E description BINDING => ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI1 45) chain A residue 136 type BINDING sequence E description BINDING => ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI1 46) chain A residue 196 type BINDING sequence E description BINDING => ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI1 47) chain A residue 203 type BINDING sequence E description BINDING => ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 253 type BINDING sequence H description BINDING => ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI1 49) chain A residue 338 type BINDING sequence E description BINDING => ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI1 50) chain A residue 246 type BINDING sequence N description BINDING => ECO:0000250|UniProtKB:P9WN39 source Swiss-Prot : SWS_FT_FI2 51) chain A residue 319 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P9WN39 source Swiss-Prot : SWS_FT_FI2 52) chain A residue 340 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P9WN39 source Swiss-Prot : SWS_FT_FI2 53) chain A residue 255 type BINDING sequence N description BINDING => ECO:0007744|PDB:2OJW, ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI3 54) chain A residue 324 type BINDING sequence R description BINDING => ECO:0007744|PDB:2OJW, ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI3 55) chain A residue 336 type BINDING sequence Y description BINDING => ECO:0007744|PDB:2OJW, ECO:0007744|PDB:2QC8 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links